Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1L9PM83

Protein Details
Accession A0A1L9PM83   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
3-36ASVRSHSPPRHSPYPNRWRRAKKDRQILIRVPEEHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 26
Family & Domain DBs
InterPro View protein in InterPro  
IPR023026  Trp_synth_beta/beta-like  
IPR001926  TrpB-like_PALP  
IPR036052  TrpB-like_PALP_sf  
Gene Ontology GO:0004834  F:tryptophan synthase activity  
Pfam View protein in Pfam  
PF00291  PALP  
Amino Acid Sequences MLASVRSHSPPRHSPYPNRWRRAKKDRQILIRVPEEKYLNPLIKSLSLELVDLLHAPVWSRHHVSIPAVDAPTRFGQFGGQFAPELQMSLLLDLPSVFHSILSDDIFWEDFLACPLIRPSPLHFAHNLTQAVGGANIWLKREDLNPFGSYQARNIVGQILFAHHIGKTEIAMDCGYAGHGLVCATMCARLKMKCTILMGSSDIAAQPDAIDKMERLGATVISAQIPGLCNSMDKGSLRAATNEALRYSLTHLDSTYHITSGTIGPHPLPSITRTFQSLLGQEIRNCLPRLTGREGNGPPADALISPMGSSGSAALGMFAPFIDDPNVRLIGVEAAGAAPLTHGSVGVMYGCKTLLLQDDNGQILPSYSIAPDLNFPCAGPELAHWKDMGRLETVTASNEEAVQGLRVLCEQEGIVSSLATGHAVLETVRVARELGVGKDVVLLVSG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.71
2 0.76
3 0.82
4 0.85
5 0.84
6 0.86
7 0.87
8 0.89
9 0.9
10 0.9
11 0.89
12 0.9
13 0.9
14 0.9
15 0.88
16 0.85
17 0.82
18 0.79
19 0.73
20 0.64
21 0.61
22 0.54
23 0.45
24 0.43
25 0.43
26 0.38
27 0.34
28 0.34
29 0.31
30 0.31
31 0.32
32 0.28
33 0.24
34 0.2
35 0.2
36 0.18
37 0.16
38 0.14
39 0.12
40 0.11
41 0.08
42 0.08
43 0.09
44 0.12
45 0.15
46 0.2
47 0.23
48 0.24
49 0.27
50 0.29
51 0.31
52 0.31
53 0.3
54 0.29
55 0.26
56 0.26
57 0.22
58 0.23
59 0.25
60 0.22
61 0.19
62 0.15
63 0.18
64 0.18
65 0.2
66 0.19
67 0.16
68 0.15
69 0.15
70 0.17
71 0.13
72 0.12
73 0.1
74 0.09
75 0.09
76 0.09
77 0.1
78 0.08
79 0.08
80 0.07
81 0.08
82 0.08
83 0.09
84 0.08
85 0.07
86 0.08
87 0.08
88 0.1
89 0.1
90 0.09
91 0.08
92 0.09
93 0.1
94 0.09
95 0.09
96 0.08
97 0.07
98 0.08
99 0.09
100 0.08
101 0.08
102 0.1
103 0.11
104 0.12
105 0.14
106 0.16
107 0.24
108 0.26
109 0.27
110 0.27
111 0.3
112 0.33
113 0.37
114 0.34
115 0.25
116 0.24
117 0.21
118 0.2
119 0.15
120 0.11
121 0.06
122 0.08
123 0.09
124 0.09
125 0.1
126 0.1
127 0.11
128 0.14
129 0.17
130 0.17
131 0.2
132 0.2
133 0.2
134 0.22
135 0.23
136 0.2
137 0.18
138 0.2
139 0.18
140 0.17
141 0.17
142 0.18
143 0.15
144 0.15
145 0.14
146 0.11
147 0.11
148 0.11
149 0.11
150 0.08
151 0.09
152 0.09
153 0.09
154 0.07
155 0.08
156 0.08
157 0.09
158 0.08
159 0.08
160 0.07
161 0.07
162 0.07
163 0.05
164 0.04
165 0.03
166 0.04
167 0.04
168 0.04
169 0.04
170 0.04
171 0.04
172 0.07
173 0.08
174 0.09
175 0.12
176 0.13
177 0.16
178 0.21
179 0.22
180 0.22
181 0.23
182 0.22
183 0.21
184 0.2
185 0.18
186 0.14
187 0.13
188 0.1
189 0.08
190 0.07
191 0.06
192 0.05
193 0.04
194 0.05
195 0.05
196 0.05
197 0.05
198 0.05
199 0.06
200 0.08
201 0.07
202 0.07
203 0.07
204 0.07
205 0.07
206 0.08
207 0.07
208 0.06
209 0.06
210 0.05
211 0.05
212 0.06
213 0.06
214 0.06
215 0.06
216 0.06
217 0.07
218 0.07
219 0.08
220 0.08
221 0.09
222 0.09
223 0.12
224 0.13
225 0.13
226 0.14
227 0.14
228 0.15
229 0.15
230 0.14
231 0.11
232 0.11
233 0.11
234 0.12
235 0.14
236 0.13
237 0.13
238 0.13
239 0.13
240 0.15
241 0.18
242 0.17
243 0.13
244 0.12
245 0.11
246 0.12
247 0.12
248 0.13
249 0.09
250 0.09
251 0.09
252 0.1
253 0.1
254 0.1
255 0.09
256 0.1
257 0.14
258 0.14
259 0.15
260 0.17
261 0.18
262 0.19
263 0.21
264 0.19
265 0.18
266 0.21
267 0.21
268 0.19
269 0.21
270 0.21
271 0.23
272 0.23
273 0.2
274 0.18
275 0.21
276 0.26
277 0.3
278 0.33
279 0.31
280 0.38
281 0.39
282 0.41
283 0.38
284 0.32
285 0.25
286 0.21
287 0.19
288 0.11
289 0.12
290 0.07
291 0.07
292 0.06
293 0.07
294 0.06
295 0.06
296 0.06
297 0.05
298 0.04
299 0.04
300 0.04
301 0.04
302 0.05
303 0.05
304 0.05
305 0.04
306 0.05
307 0.05
308 0.06
309 0.08
310 0.08
311 0.09
312 0.13
313 0.13
314 0.12
315 0.12
316 0.12
317 0.1
318 0.1
319 0.09
320 0.06
321 0.05
322 0.05
323 0.05
324 0.04
325 0.03
326 0.03
327 0.04
328 0.03
329 0.03
330 0.04
331 0.04
332 0.04
333 0.05
334 0.06
335 0.06
336 0.07
337 0.07
338 0.07
339 0.07
340 0.08
341 0.12
342 0.13
343 0.14
344 0.18
345 0.21
346 0.22
347 0.22
348 0.2
349 0.16
350 0.14
351 0.13
352 0.1
353 0.08
354 0.07
355 0.09
356 0.09
357 0.1
358 0.15
359 0.16
360 0.18
361 0.17
362 0.17
363 0.17
364 0.18
365 0.17
366 0.13
367 0.14
368 0.19
369 0.21
370 0.22
371 0.2
372 0.19
373 0.24
374 0.27
375 0.26
376 0.2
377 0.19
378 0.2
379 0.23
380 0.23
381 0.2
382 0.18
383 0.17
384 0.15
385 0.15
386 0.14
387 0.11
388 0.11
389 0.09
390 0.09
391 0.09
392 0.09
393 0.09
394 0.11
395 0.1
396 0.1
397 0.1
398 0.09
399 0.11
400 0.12
401 0.11
402 0.1
403 0.1
404 0.1
405 0.1
406 0.09
407 0.07
408 0.06
409 0.06
410 0.06
411 0.06
412 0.07
413 0.08
414 0.09
415 0.09
416 0.1
417 0.1
418 0.1
419 0.15
420 0.17
421 0.17
422 0.19
423 0.19
424 0.18
425 0.2
426 0.19