Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1L9PTR5

Protein Details
Accession A0A1L9PTR5    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
24-44QEKKKLPKGRAMKRLKYTRRFBasic
NLS Segment(s)
PositionSequence
12-41GKVKSATPKVEPQEKKKLPKGRAMKRLKYT
Subcellular Location(s) nucl 13.5, mito_nucl 13, mito 11.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR006846  Ribosomal_S30  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF04758  Ribosomal_S30  
Amino Acid Sequences MGKVHGSLARAGKVKSATPKVEPQEKKKLPKGRAMKRLKYTRRFVNVTMTGGKRKMNPNPGN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.35
3 0.38
4 0.36
5 0.37
6 0.44
7 0.46
8 0.54
9 0.55
10 0.54
11 0.59
12 0.62
13 0.65
14 0.66
15 0.69
16 0.63
17 0.66
18 0.69
19 0.67
20 0.72
21 0.73
22 0.73
23 0.74
24 0.8
25 0.81
26 0.79
27 0.76
28 0.75
29 0.74
30 0.7
31 0.62
32 0.61
33 0.55
34 0.49
35 0.49
36 0.43
37 0.4
38 0.38
39 0.4
40 0.37
41 0.42
42 0.47