Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1L9PMX9

Protein Details
Accession A0A1L9PMX9    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
13-36TTLAKTLFKRPGRRRTPPSQYDNLHydrophilic
NLS Segment(s)
PositionSequence
25-25R
Subcellular Location(s) mito_nucl 11.166, nucl 11, mito 11
Family & Domain DBs
Amino Acid Sequences MTPLKRAVKKIATTLAKTLFKRPGRRRTPPSQYDNLPKFSRLTSEILQELRRKTDHLRPQFRYWPHRLSQLAPDYLEDCSITRLNDIRRFSRRGGADLSDLRGVCCFAHLSTDQN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.54
3 0.52
4 0.5
5 0.51
6 0.51
7 0.52
8 0.6
9 0.65
10 0.68
11 0.7
12 0.79
13 0.81
14 0.82
15 0.85
16 0.83
17 0.81
18 0.76
19 0.72
20 0.72
21 0.67
22 0.63
23 0.53
24 0.46
25 0.4
26 0.34
27 0.31
28 0.24
29 0.24
30 0.2
31 0.21
32 0.22
33 0.23
34 0.25
35 0.26
36 0.24
37 0.23
38 0.22
39 0.21
40 0.23
41 0.31
42 0.37
43 0.43
44 0.5
45 0.52
46 0.57
47 0.62
48 0.63
49 0.62
50 0.58
51 0.53
52 0.46
53 0.48
54 0.44
55 0.39
56 0.41
57 0.39
58 0.35
59 0.29
60 0.28
61 0.23
62 0.21
63 0.2
64 0.13
65 0.08
66 0.1
67 0.11
68 0.1
69 0.12
70 0.16
71 0.22
72 0.28
73 0.32
74 0.36
75 0.41
76 0.45
77 0.45
78 0.49
79 0.45
80 0.41
81 0.41
82 0.37
83 0.37
84 0.35
85 0.35
86 0.32
87 0.29
88 0.26
89 0.23
90 0.21
91 0.15
92 0.15
93 0.13
94 0.1
95 0.15