Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1L9PUI0

Protein Details
Accession A0A1L9PUI0    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-30MIMQGRTWRRDRERRSRRRRTKADERVGLGBasic
NLS Segment(s)
PositionSequence
9-24RRDRERRSRRRRTKAD
Subcellular Location(s) nucl 12, cyto_nucl 9.5, mito 8, cyto 5
Family & Domain DBs
Amino Acid Sequences MIMQGRTWRRDRERRSRRRRTKADERVGLGHRTTRVRAGLSPSGNRFIIAGSLSVSPVPSIGQTFVWHSFTSCQQDPSLLYEIRSVSSRSRHLAPSPTPCCAFPVPNI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.91
3 0.93
4 0.94
5 0.94
6 0.95
7 0.93
8 0.93
9 0.93
10 0.92
11 0.87
12 0.79
13 0.74
14 0.67
15 0.59
16 0.48
17 0.41
18 0.34
19 0.31
20 0.28
21 0.25
22 0.24
23 0.23
24 0.24
25 0.27
26 0.28
27 0.29
28 0.31
29 0.29
30 0.3
31 0.29
32 0.27
33 0.21
34 0.15
35 0.13
36 0.1
37 0.08
38 0.06
39 0.06
40 0.06
41 0.06
42 0.06
43 0.05
44 0.05
45 0.05
46 0.04
47 0.04
48 0.05
49 0.06
50 0.07
51 0.09
52 0.11
53 0.13
54 0.12
55 0.13
56 0.14
57 0.17
58 0.23
59 0.21
60 0.21
61 0.2
62 0.21
63 0.22
64 0.24
65 0.25
66 0.19
67 0.19
68 0.2
69 0.2
70 0.2
71 0.21
72 0.18
73 0.18
74 0.23
75 0.27
76 0.28
77 0.32
78 0.34
79 0.37
80 0.43
81 0.45
82 0.5
83 0.5
84 0.51
85 0.48
86 0.45
87 0.46
88 0.41