Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1L9P5V8

Protein Details
Accession A0A1L9P5V8    Localization Confidence Medium Confidence Score 14.9
NoLS Segment(s)
PositionSequenceProtein Nature
16-39GAKVSDGRVKKKKSSKKGSSAATAHydrophilic
NLS Segment(s)
PositionSequence
10-34GKLKLKGAKVSDGRVKKKKSSKKGS
102-124KRHEEMRKKRVLERLKREGIKTH
Subcellular Location(s) nucl 17.5, cyto_nucl 9.5, mito 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR013865  FAM32A  
Pfam View protein in Pfam  
PF08555  FAM32A  
Amino Acid Sequences MDEYSAGGGGKLKLKGAKVSDGRVKKKKSSKKGSSAATAAGAGGAEKEGEKSSEAAAAAAGEEGSSTTTGALPGEEGEEGDGSSTPQSQSQSHAPAKTEAEKRHEEMRKKRVLERLKREGIKTHKERVEELNKYLSRLSEHHDMPKIGPG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.3
3 0.31
4 0.38
5 0.36
6 0.43
7 0.49
8 0.54
9 0.62
10 0.65
11 0.67
12 0.68
13 0.74
14 0.78
15 0.8
16 0.82
17 0.82
18 0.83
19 0.85
20 0.81
21 0.76
22 0.66
23 0.56
24 0.46
25 0.36
26 0.25
27 0.17
28 0.12
29 0.07
30 0.05
31 0.04
32 0.03
33 0.03
34 0.05
35 0.05
36 0.06
37 0.07
38 0.08
39 0.08
40 0.1
41 0.09
42 0.08
43 0.08
44 0.07
45 0.06
46 0.05
47 0.05
48 0.03
49 0.03
50 0.03
51 0.03
52 0.03
53 0.03
54 0.04
55 0.04
56 0.04
57 0.04
58 0.04
59 0.04
60 0.04
61 0.04
62 0.04
63 0.04
64 0.04
65 0.04
66 0.04
67 0.04
68 0.04
69 0.04
70 0.04
71 0.05
72 0.05
73 0.07
74 0.09
75 0.09
76 0.13
77 0.17
78 0.23
79 0.26
80 0.27
81 0.27
82 0.27
83 0.29
84 0.33
85 0.36
86 0.33
87 0.36
88 0.37
89 0.39
90 0.46
91 0.51
92 0.52
93 0.55
94 0.61
95 0.64
96 0.64
97 0.67
98 0.67
99 0.7
100 0.72
101 0.72
102 0.72
103 0.73
104 0.73
105 0.7
106 0.69
107 0.67
108 0.67
109 0.64
110 0.63
111 0.59
112 0.57
113 0.58
114 0.58
115 0.6
116 0.53
117 0.5
118 0.51
119 0.47
120 0.47
121 0.45
122 0.37
123 0.31
124 0.29
125 0.32
126 0.3
127 0.33
128 0.38
129 0.42
130 0.42