Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1L9PV90

Protein Details
Accession A0A1L9PV90   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
282-302DKLPRGQKKFRVRKVTLNNFLHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 15.5, cyto_mito 13, mito 9.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000683  Gfo/Idh/MocA-like_OxRdtase_N  
IPR036291  NAD(P)-bd_dom_sf  
Gene Ontology GO:0000166  F:nucleotide binding  
Pfam View protein in Pfam  
PF01408  GFO_IDH_MocA  
Amino Acid Sequences MASLLGFVARNWQMSSPSEVPKTPNALKFGILGAANIAKSVLINPAKTHPEVKVQAVAARDKHRAVAYARKHGIPQVHESYEAILDDPSIDVVYIPLPPSLHFEWALKALNKGKHVLVEKPAVVNAIEAETLFRSPVLQKPKAPILLEAMHHRFQPSWQYFISLVDRSSLDRVVSIGKLPSYIIPKTSVQLGYETGGGNLLNLGTYGMCVLREIIGAEPEECTKCTVRRTPLDELCDEAAEATFRFPHGLVGEIVTDMRASVFILPTFITTVVHKEVLVEDDKLPRGQKKFRVRKVTLNNFLMAAAWHRIDIEDEFIIKKVDGETNKVIKRWSNKESRKIYTFKDAGLDQPGEPSWSSWRHELEQFVNRVRDREGSGLWLSNEDSLKQAKMIDLAYEKAGLPLRPTGSVLHPSVSE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.33
3 0.31
4 0.36
5 0.37
6 0.38
7 0.4
8 0.43
9 0.48
10 0.47
11 0.47
12 0.45
13 0.43
14 0.42
15 0.39
16 0.34
17 0.3
18 0.23
19 0.17
20 0.15
21 0.16
22 0.15
23 0.13
24 0.12
25 0.09
26 0.09
27 0.1
28 0.16
29 0.17
30 0.18
31 0.21
32 0.27
33 0.32
34 0.34
35 0.35
36 0.3
37 0.36
38 0.38
39 0.39
40 0.38
41 0.34
42 0.35
43 0.36
44 0.38
45 0.34
46 0.36
47 0.37
48 0.33
49 0.36
50 0.34
51 0.35
52 0.34
53 0.38
54 0.4
55 0.46
56 0.49
57 0.46
58 0.46
59 0.46
60 0.48
61 0.42
62 0.42
63 0.38
64 0.37
65 0.36
66 0.35
67 0.32
68 0.27
69 0.24
70 0.16
71 0.1
72 0.08
73 0.08
74 0.08
75 0.06
76 0.05
77 0.05
78 0.04
79 0.05
80 0.06
81 0.06
82 0.07
83 0.08
84 0.08
85 0.09
86 0.15
87 0.16
88 0.18
89 0.18
90 0.18
91 0.18
92 0.21
93 0.25
94 0.21
95 0.24
96 0.28
97 0.3
98 0.32
99 0.32
100 0.3
101 0.31
102 0.33
103 0.33
104 0.31
105 0.31
106 0.3
107 0.28
108 0.28
109 0.23
110 0.2
111 0.16
112 0.12
113 0.08
114 0.07
115 0.06
116 0.07
117 0.07
118 0.07
119 0.07
120 0.06
121 0.06
122 0.08
123 0.14
124 0.22
125 0.25
126 0.28
127 0.32
128 0.38
129 0.4
130 0.39
131 0.34
132 0.31
133 0.3
134 0.29
135 0.31
136 0.3
137 0.27
138 0.27
139 0.26
140 0.21
141 0.2
142 0.28
143 0.24
144 0.23
145 0.22
146 0.24
147 0.24
148 0.26
149 0.28
150 0.19
151 0.17
152 0.15
153 0.16
154 0.14
155 0.15
156 0.13
157 0.1
158 0.09
159 0.1
160 0.1
161 0.1
162 0.1
163 0.09
164 0.08
165 0.09
166 0.09
167 0.11
168 0.13
169 0.13
170 0.13
171 0.15
172 0.16
173 0.16
174 0.19
175 0.17
176 0.14
177 0.14
178 0.14
179 0.12
180 0.12
181 0.12
182 0.08
183 0.08
184 0.07
185 0.06
186 0.05
187 0.04
188 0.03
189 0.03
190 0.03
191 0.02
192 0.03
193 0.03
194 0.03
195 0.03
196 0.03
197 0.04
198 0.04
199 0.04
200 0.05
201 0.05
202 0.06
203 0.06
204 0.06
205 0.07
206 0.08
207 0.08
208 0.08
209 0.1
210 0.1
211 0.13
212 0.17
213 0.23
214 0.27
215 0.33
216 0.38
217 0.44
218 0.46
219 0.47
220 0.43
221 0.39
222 0.34
223 0.28
224 0.22
225 0.14
226 0.1
227 0.07
228 0.07
229 0.05
230 0.05
231 0.05
232 0.06
233 0.06
234 0.07
235 0.07
236 0.09
237 0.08
238 0.09
239 0.09
240 0.08
241 0.08
242 0.07
243 0.06
244 0.04
245 0.04
246 0.03
247 0.04
248 0.05
249 0.05
250 0.05
251 0.06
252 0.07
253 0.07
254 0.08
255 0.08
256 0.07
257 0.07
258 0.1
259 0.11
260 0.12
261 0.11
262 0.11
263 0.11
264 0.13
265 0.14
266 0.13
267 0.13
268 0.16
269 0.18
270 0.19
271 0.21
272 0.24
273 0.29
274 0.35
275 0.42
276 0.5
277 0.59
278 0.67
279 0.75
280 0.73
281 0.77
282 0.81
283 0.82
284 0.79
285 0.71
286 0.62
287 0.52
288 0.48
289 0.38
290 0.27
291 0.19
292 0.12
293 0.1
294 0.09
295 0.09
296 0.09
297 0.11
298 0.11
299 0.12
300 0.1
301 0.11
302 0.12
303 0.12
304 0.13
305 0.11
306 0.11
307 0.11
308 0.16
309 0.17
310 0.22
311 0.29
312 0.36
313 0.39
314 0.4
315 0.4
316 0.4
317 0.47
318 0.49
319 0.51
320 0.53
321 0.6
322 0.68
323 0.74
324 0.76
325 0.74
326 0.71
327 0.66
328 0.65
329 0.58
330 0.49
331 0.45
332 0.38
333 0.34
334 0.35
335 0.32
336 0.22
337 0.23
338 0.22
339 0.2
340 0.19
341 0.18
342 0.19
343 0.22
344 0.25
345 0.27
346 0.31
347 0.34
348 0.37
349 0.4
350 0.41
351 0.44
352 0.47
353 0.47
354 0.5
355 0.47
356 0.46
357 0.43
358 0.4
359 0.36
360 0.35
361 0.3
362 0.28
363 0.29
364 0.3
365 0.28
366 0.26
367 0.23
368 0.23
369 0.23
370 0.19
371 0.2
372 0.19
373 0.2
374 0.19
375 0.19
376 0.16
377 0.18
378 0.18
379 0.2
380 0.2
381 0.21
382 0.21
383 0.21
384 0.2
385 0.21
386 0.24
387 0.2
388 0.2
389 0.25
390 0.26
391 0.25
392 0.27
393 0.26
394 0.28
395 0.33
396 0.32