Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1L9P862

Protein Details
Accession A0A1L9P862   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
64-86LRAVPKKKTSHMKKRHRQMAGKABasic
NLS Segment(s)
PositionSequence
68-83PKKKTSHMKKRHRQMA
Subcellular Location(s) mito 23, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR002677  Ribosomal_L32p  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:0015934  C:large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01783  Ribosomal_L32p  
Amino Acid Sequences MALRLVSPNPLLQIFPRLVVPSKSLPLTISLPSQHQVFLSAFVRPVAFALNVPGLLSDLWESVLRAVPKKKTSHMKKRHRQMAGKALKDVRNLNTCPACGQIKRSHVLCQHCVENIKKQWGKAQLS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.18
3 0.19
4 0.19
5 0.21
6 0.22
7 0.24
8 0.22
9 0.25
10 0.24
11 0.23
12 0.21
13 0.22
14 0.23
15 0.2
16 0.19
17 0.18
18 0.19
19 0.2
20 0.2
21 0.17
22 0.14
23 0.15
24 0.13
25 0.15
26 0.14
27 0.13
28 0.13
29 0.13
30 0.13
31 0.1
32 0.1
33 0.07
34 0.07
35 0.06
36 0.07
37 0.07
38 0.07
39 0.07
40 0.07
41 0.06
42 0.05
43 0.06
44 0.04
45 0.04
46 0.05
47 0.05
48 0.05
49 0.05
50 0.08
51 0.09
52 0.11
53 0.15
54 0.19
55 0.24
56 0.27
57 0.32
58 0.41
59 0.51
60 0.59
61 0.66
62 0.73
63 0.77
64 0.85
65 0.88
66 0.85
67 0.81
68 0.77
69 0.77
70 0.75
71 0.67
72 0.61
73 0.58
74 0.53
75 0.5
76 0.46
77 0.41
78 0.38
79 0.37
80 0.39
81 0.36
82 0.33
83 0.3
84 0.31
85 0.3
86 0.25
87 0.3
88 0.31
89 0.34
90 0.38
91 0.39
92 0.42
93 0.44
94 0.5
95 0.49
96 0.46
97 0.44
98 0.42
99 0.46
100 0.43
101 0.46
102 0.46
103 0.52
104 0.5
105 0.5
106 0.53