Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1L9PAI6

Protein Details
Accession A0A1L9PAI6   
Localization Confidence Medium
Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-31MANQKARRRKKKKKKKKKKVPTTSQLQKIAKBasic
NLS Segment(s)
PositionSequence
5-20KARRRKKKKKKKKKKV
Subcellular Location(s) nucl 15.5, cyto_nucl 10.5, mito 9
Family & Domain DBs
Amino Acid Sequences MANQKARRRKKKKKKKKKKVPTTSQLQKIAKDQPRSRRILIQNKSEDAWTICHKQKRYEIYPSSSADEVSTVCRYFHYL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.98
2 0.98
3 0.98
4 0.98
5 0.98
6 0.97
7 0.97
8 0.95
9 0.94
10 0.91
11 0.88
12 0.85
13 0.76
14 0.66
15 0.59
16 0.59
17 0.55
18 0.54
19 0.52
20 0.54
21 0.59
22 0.62
23 0.59
24 0.58
25 0.6
26 0.61
27 0.6
28 0.58
29 0.54
30 0.51
31 0.49
32 0.41
33 0.34
34 0.25
35 0.23
36 0.18
37 0.21
38 0.25
39 0.31
40 0.33
41 0.37
42 0.44
43 0.49
44 0.51
45 0.55
46 0.55
47 0.55
48 0.58
49 0.55
50 0.51
51 0.43
52 0.38
53 0.28
54 0.24
55 0.18
56 0.17
57 0.18
58 0.15
59 0.15