Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1L9Q050

Protein Details
Accession A0A1L9Q050    Localization Confidence Low Confidence Score 5.6
NoLS Segment(s)
PositionSequenceProtein Nature
115-136SIPANKFYRLRRRKLRSLLAEDHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 14.5, cyto_mito 9.5, cyto 3.5, nucl 2, plas 2, extr 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR002938  FAD-bd  
IPR036188  FAD/NAD-bd_sf  
Gene Ontology GO:0071949  F:FAD binding  
GO:0016491  F:oxidoreductase activity  
GO:0044550  P:secondary metabolite biosynthetic process  
Pfam View protein in Pfam  
PF01494  FAD_binding_3  
Amino Acid Sequences MSVLRRLSALVQGRQTAAPDTTVLIVGAGSTGLALAQGLKKAGIPYIVVEKNESLHAQPRDWNMGMHWGAESLQALLPPSKWARLQSVQVDPSTPTPDTDAINFLNGQTGDLMTSIPANKFYRLRRRKLRSLLAEDLTIRYSHKIESITYSPDGKHAIAHFTNNNTIKASLIVGADGARSAVRSHLLGPELGSVRTLPYSATFVQARYSAEQALFLRKFHPLYLASINPANLFAFFGLHDIPDPAKPETWTFFFYISWPCSLEEQVQTAHWTDAQRLQQGKDFSKHFTEPWKSAYEWLPDDQKVWYMNLTDFDPGAEGHRWDTHDGRVTLAGDAAHAMTYQRGQGLNHSITDAGRLAAAIKDFVKEKRRRADAVAQYEEEMIARGGGEVRMSSTNTEMVHDWSKVQESPIMKSGMTKVQDIKKQQA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.36
3 0.32
4 0.25
5 0.21
6 0.18
7 0.17
8 0.15
9 0.15
10 0.13
11 0.1
12 0.09
13 0.07
14 0.07
15 0.05
16 0.04
17 0.03
18 0.03
19 0.03
20 0.03
21 0.03
22 0.06
23 0.08
24 0.1
25 0.1
26 0.11
27 0.13
28 0.14
29 0.15
30 0.14
31 0.13
32 0.14
33 0.22
34 0.25
35 0.24
36 0.25
37 0.24
38 0.24
39 0.26
40 0.25
41 0.18
42 0.24
43 0.26
44 0.26
45 0.3
46 0.33
47 0.38
48 0.37
49 0.35
50 0.28
51 0.33
52 0.32
53 0.27
54 0.23
55 0.16
56 0.16
57 0.17
58 0.16
59 0.09
60 0.09
61 0.09
62 0.11
63 0.11
64 0.11
65 0.15
66 0.17
67 0.19
68 0.2
69 0.23
70 0.29
71 0.32
72 0.38
73 0.39
74 0.44
75 0.43
76 0.41
77 0.4
78 0.34
79 0.32
80 0.31
81 0.25
82 0.18
83 0.18
84 0.2
85 0.19
86 0.19
87 0.2
88 0.16
89 0.17
90 0.16
91 0.14
92 0.16
93 0.14
94 0.13
95 0.1
96 0.1
97 0.09
98 0.09
99 0.09
100 0.05
101 0.07
102 0.09
103 0.09
104 0.14
105 0.15
106 0.19
107 0.25
108 0.33
109 0.43
110 0.5
111 0.59
112 0.65
113 0.73
114 0.79
115 0.82
116 0.83
117 0.81
118 0.79
119 0.76
120 0.66
121 0.59
122 0.49
123 0.41
124 0.32
125 0.24
126 0.17
127 0.13
128 0.12
129 0.11
130 0.13
131 0.13
132 0.13
133 0.18
134 0.2
135 0.21
136 0.22
137 0.23
138 0.2
139 0.2
140 0.22
141 0.17
142 0.17
143 0.14
144 0.18
145 0.18
146 0.21
147 0.21
148 0.21
149 0.28
150 0.27
151 0.27
152 0.22
153 0.21
154 0.19
155 0.17
156 0.16
157 0.11
158 0.09
159 0.08
160 0.07
161 0.07
162 0.07
163 0.06
164 0.05
165 0.04
166 0.04
167 0.04
168 0.05
169 0.06
170 0.06
171 0.07
172 0.09
173 0.1
174 0.1
175 0.1
176 0.12
177 0.12
178 0.12
179 0.11
180 0.09
181 0.09
182 0.09
183 0.09
184 0.06
185 0.06
186 0.09
187 0.09
188 0.12
189 0.12
190 0.12
191 0.13
192 0.14
193 0.14
194 0.13
195 0.13
196 0.11
197 0.1
198 0.12
199 0.12
200 0.17
201 0.16
202 0.15
203 0.16
204 0.17
205 0.18
206 0.16
207 0.18
208 0.13
209 0.15
210 0.18
211 0.18
212 0.17
213 0.17
214 0.17
215 0.14
216 0.13
217 0.1
218 0.07
219 0.07
220 0.05
221 0.05
222 0.05
223 0.06
224 0.05
225 0.05
226 0.05
227 0.06
228 0.07
229 0.08
230 0.1
231 0.1
232 0.11
233 0.12
234 0.14
235 0.16
236 0.17
237 0.18
238 0.16
239 0.16
240 0.15
241 0.16
242 0.19
243 0.17
244 0.16
245 0.15
246 0.15
247 0.15
248 0.16
249 0.17
250 0.14
251 0.14
252 0.14
253 0.13
254 0.14
255 0.13
256 0.13
257 0.12
258 0.12
259 0.12
260 0.17
261 0.2
262 0.24
263 0.25
264 0.26
265 0.28
266 0.32
267 0.34
268 0.33
269 0.33
270 0.3
271 0.33
272 0.33
273 0.31
274 0.35
275 0.37
276 0.34
277 0.35
278 0.35
279 0.31
280 0.33
281 0.36
282 0.32
283 0.29
284 0.29
285 0.3
286 0.27
287 0.28
288 0.25
289 0.23
290 0.19
291 0.18
292 0.17
293 0.14
294 0.14
295 0.15
296 0.16
297 0.14
298 0.12
299 0.12
300 0.11
301 0.1
302 0.12
303 0.11
304 0.11
305 0.12
306 0.15
307 0.17
308 0.19
309 0.21
310 0.23
311 0.28
312 0.28
313 0.27
314 0.27
315 0.26
316 0.23
317 0.22
318 0.17
319 0.1
320 0.1
321 0.09
322 0.07
323 0.06
324 0.06
325 0.06
326 0.07
327 0.08
328 0.1
329 0.11
330 0.12
331 0.17
332 0.24
333 0.24
334 0.24
335 0.24
336 0.22
337 0.2
338 0.22
339 0.18
340 0.11
341 0.09
342 0.08
343 0.09
344 0.1
345 0.1
346 0.1
347 0.1
348 0.12
349 0.15
350 0.22
351 0.31
352 0.37
353 0.45
354 0.53
355 0.59
356 0.6
357 0.64
358 0.68
359 0.67
360 0.69
361 0.65
362 0.56
363 0.51
364 0.48
365 0.41
366 0.3
367 0.22
368 0.13
369 0.08
370 0.07
371 0.06
372 0.07
373 0.08
374 0.08
375 0.08
376 0.1
377 0.13
378 0.14
379 0.15
380 0.15
381 0.18
382 0.18
383 0.2
384 0.19
385 0.21
386 0.24
387 0.24
388 0.23
389 0.22
390 0.25
391 0.24
392 0.25
393 0.25
394 0.24
395 0.28
396 0.33
397 0.32
398 0.28
399 0.3
400 0.33
401 0.36
402 0.35
403 0.35
404 0.37
405 0.44
406 0.51