FuNGI

A0A1L9PZG3

Protein Details

Accession

A0A1L9PZG3

Localization Confidence

Medium

Confidence Score

13.9

NoLS Segment(s)

Position	Sequence	Protein Nature
337-357	MRWRADQKYGRKAPRRKAPNG	Basic

NLS Segment(s)

Position	Sequence
346-354	GRKAPRRKA

Subcellular Location(s)

nucl 16, cyto 6, mito 5

Family & Domain DBs

InterPro	View protein in InterPro IPR009203 Knr4/Smi1 IPR018958 Knr4/Smi1-like_dom IPR037883 Knr4/Smi1-like_sf
Gene Ontology	GO:0042546 P:cell wall biogenesis
Pfam	View protein in Pfam PF09346 SMI1_KNR4

Amino Acid Sequences

MTSYDRHASHDSPYRTGRHVPLSQSRHEPLTSIATSAIESRPDLTSPYEDEQPNGVSSPNRPYSPGMRSMSSHTRQSGDHGADGAPEIQMQSFHDGAPPPPPVSHSWRKIERWLENHYEELYDNLCEGCTQNDINELEHELDCSLPLEVRESLMNHDGQERPGLPTGIIFGCMLLDCEEIVQEWKNWRTVNEEFLASPTMVNTPIPKATASSSSATPPQASNPMWRQDLLERQDSQPPGAVQKAYAHPAWIPLARDWGGNCIAIDLAPGPAGKWGQVIIFGRDYDCKYVIARSWATFLAVFSDDICSGKAVVEEDSNELKLLEFKAQNVEPPYLEIMRWRADQKYGRKAPRRKAPNGLGLNTSTRSGKESPYGSPGPGEERGRSPHRFPNRGSTQSPKTQFGMSSPLARVTEEASSPVHGTTESEPADNTTKPATKESNSEDLLEVATPQASGKENEGFGEQQPASKADPEKLQRREPSQGTPTAGLDNEVLGEMKNVAI

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.49
2	0.48
3	0.53
4	0.51
5	0.5
6	0.51
7	0.53
8	0.58
9	0.59
10	0.61
11	0.62
12	0.59
13	0.54
14	0.49
15	0.42
16	0.35
17	0.37
18	0.32
19	0.25
20	0.23
21	0.19
22	0.2
23	0.22
24	0.2
25	0.14
26	0.14
27	0.15
28	0.16
29	0.16
30	0.18
31	0.18
32	0.2
33	0.23
34	0.26
35	0.31
36	0.29
37	0.3
38	0.31
39	0.29
40	0.27
41	0.23
42	0.21
43	0.17
44	0.19
45	0.27
46	0.3
47	0.29
48	0.3
49	0.34
50	0.39
51	0.42
52	0.48
53	0.42
54	0.39
55	0.4
56	0.45
57	0.5
58	0.48
59	0.47
60	0.41
61	0.4
62	0.38
63	0.42
64	0.42
65	0.35
66	0.31
67	0.27
68	0.25
69	0.23
70	0.24
71	0.19
72	0.11
73	0.09
74	0.08
75	0.07
76	0.08
77	0.09
78	0.12
79	0.12
80	0.12
81	0.15
82	0.16
83	0.16
84	0.21
85	0.22
86	0.19
87	0.19
88	0.22
89	0.24
90	0.31
91	0.4
92	0.42
93	0.48
94	0.54
95	0.57
96	0.62
97	0.66
98	0.65
99	0.61
100	0.6
101	0.59
102	0.53
103	0.52
104	0.45
105	0.37
106	0.3
107	0.26
108	0.2
109	0.13
110	0.11
111	0.09
112	0.09
113	0.08
114	0.08
115	0.08
116	0.09
117	0.09
118	0.09
119	0.14
120	0.15
121	0.16
122	0.16
123	0.16
124	0.16
125	0.16
126	0.16
127	0.11
128	0.1
129	0.09
130	0.09
131	0.08
132	0.06
133	0.06
134	0.09
135	0.09
136	0.09
137	0.11
138	0.11
139	0.14
140	0.16
141	0.16
142	0.14
143	0.18
144	0.18
145	0.17
146	0.19
147	0.17
148	0.17
149	0.18
150	0.18
151	0.14
152	0.13
153	0.15
154	0.12
155	0.12
156	0.09
157	0.07
158	0.07
159	0.07
160	0.08
161	0.06
162	0.06
163	0.05
164	0.05
165	0.05
166	0.05
167	0.07
168	0.07
169	0.08
170	0.13
171	0.15
172	0.18
173	0.19
174	0.19
175	0.24
176	0.25
177	0.27
178	0.24
179	0.23
180	0.19
181	0.2
182	0.2
183	0.14
184	0.12
185	0.09
186	0.08
187	0.08
188	0.08
189	0.08
190	0.09
191	0.09
192	0.1
193	0.1
194	0.1
195	0.11
196	0.14
197	0.15
198	0.15
199	0.15
200	0.16
201	0.18
202	0.18
203	0.17
204	0.14
205	0.14
206	0.17
207	0.17
208	0.21
209	0.23
210	0.26
211	0.26
212	0.26
213	0.26
214	0.24
215	0.31
216	0.29
217	0.29
218	0.26
219	0.27
220	0.32
221	0.31
222	0.28
223	0.23
224	0.2
225	0.17
226	0.17
227	0.15
228	0.11
229	0.14
230	0.15
231	0.15
232	0.15
233	0.14
234	0.12
235	0.14
236	0.15
237	0.13
238	0.13
239	0.1
240	0.13
241	0.13
242	0.14
243	0.13
244	0.14
245	0.13
246	0.12
247	0.11
248	0.08
249	0.08
250	0.07
251	0.07
252	0.05
253	0.04
254	0.04
255	0.04
256	0.04
257	0.05
258	0.06
259	0.06
260	0.06
261	0.06
262	0.05
263	0.09
264	0.1
265	0.11
266	0.12
267	0.12
268	0.12
269	0.14
270	0.15
271	0.14
272	0.14
273	0.12
274	0.12
275	0.14
276	0.14
277	0.16
278	0.17
279	0.15
280	0.17
281	0.16
282	0.16
283	0.15
284	0.13
285	0.11
286	0.1
287	0.1
288	0.08
289	0.09
290	0.09
291	0.09
292	0.09
293	0.07
294	0.06
295	0.07
296	0.07
297	0.07
298	0.07
299	0.08
300	0.08
301	0.11
302	0.12
303	0.12
304	0.11
305	0.1
306	0.09
307	0.11
308	0.11
309	0.13
310	0.13
311	0.14
312	0.18
313	0.18
314	0.22
315	0.23
316	0.23
317	0.17
318	0.18
319	0.2
320	0.16
321	0.16
322	0.15
323	0.15
324	0.17
325	0.19
326	0.2
327	0.19
328	0.25
329	0.33
330	0.39
331	0.46
332	0.52
333	0.6
334	0.68
335	0.75
336	0.77
337	0.8
338	0.81
339	0.76
340	0.77
341	0.75
342	0.74
343	0.71
344	0.64
345	0.56
346	0.48
347	0.45
348	0.36
349	0.31
350	0.22
351	0.17
352	0.19
353	0.18
354	0.19
355	0.22
356	0.23
357	0.24
358	0.29
359	0.3
360	0.26
361	0.26
362	0.24
363	0.23
364	0.26
365	0.27
366	0.22
367	0.25
368	0.31
369	0.36
370	0.39
371	0.4
372	0.44
373	0.51
374	0.55
375	0.54
376	0.59
377	0.61
378	0.63
379	0.62
380	0.61
381	0.58
382	0.61
383	0.63
384	0.56
385	0.49
386	0.45
387	0.41
388	0.35
389	0.35
390	0.28
391	0.28
392	0.26
393	0.28
394	0.26
395	0.25
396	0.24
397	0.19
398	0.2
399	0.15
400	0.16
401	0.13
402	0.14
403	0.15
404	0.14
405	0.13
406	0.1
407	0.12
408	0.13
409	0.19
410	0.18
411	0.18
412	0.18
413	0.21
414	0.24
415	0.22
416	0.22
417	0.21
418	0.24
419	0.26
420	0.31
421	0.33
422	0.32
423	0.39
424	0.43
425	0.45
426	0.42
427	0.42
428	0.37
429	0.32
430	0.31
431	0.24
432	0.18
433	0.11
434	0.09
435	0.08
436	0.07
437	0.09
438	0.11
439	0.12
440	0.15
441	0.19
442	0.19
443	0.2
444	0.23
445	0.22
446	0.2
447	0.27
448	0.24
449	0.22
450	0.23
451	0.25
452	0.24
453	0.28
454	0.3
455	0.27
456	0.35
457	0.42
458	0.5
459	0.54
460	0.61
461	0.63
462	0.67
463	0.71
464	0.67
465	0.67
466	0.64
467	0.63
468	0.58
469	0.53
470	0.48
471	0.42
472	0.38
473	0.3
474	0.24
475	0.18
476	0.15
477	0.13
478	0.11
479	0.08
480	0.09

A0A1L9PZG3

3D AlphaFold-predicted Structure Viewer