Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1L9PN17

Protein Details
Accession A0A1L9PN17   
Localization Confidence Medium
Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
75-110GKIVRVRSREGRRNRAPPPRIRYNKDGKKLNPPQAAHydrophilic
NLS Segment(s)
PositionSequence
79-106RVRSREGRRNRAPPPRIRYNKDGKKLNP
Subcellular Location(s) mito 13.5, mito_nucl 11, nucl 7.5, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR000892  Ribosomal_S26e  
IPR038551  Ribosomal_S26e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01283  Ribosomal_S26e  
PROSITE View protein in PROSITE  
PS00733  RIBOSOMAL_S26E  
Amino Acid Sequences HSGRNKNGRGHVNPVRCSNCARCVPKDKAIKRFTIRNMVESAAIRDISDASVFTDYAVPKMYLKLQYCVSCAIHGKIVRVRSREGRRNRAPPPRIRYNKDGKKLNPPQAAKAM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.66
2 0.61
3 0.54
4 0.55
5 0.51
6 0.5
7 0.51
8 0.52
9 0.51
10 0.56
11 0.6
12 0.63
13 0.68
14 0.67
15 0.68
16 0.66
17 0.67
18 0.63
19 0.65
20 0.61
21 0.61
22 0.55
23 0.47
24 0.45
25 0.38
26 0.35
27 0.28
28 0.25
29 0.16
30 0.15
31 0.12
32 0.1
33 0.1
34 0.08
35 0.08
36 0.06
37 0.05
38 0.06
39 0.06
40 0.06
41 0.08
42 0.08
43 0.08
44 0.09
45 0.09
46 0.08
47 0.1
48 0.12
49 0.15
50 0.17
51 0.19
52 0.21
53 0.22
54 0.23
55 0.25
56 0.22
57 0.19
58 0.19
59 0.18
60 0.19
61 0.19
62 0.21
63 0.22
64 0.28
65 0.31
66 0.31
67 0.35
68 0.4
69 0.49
70 0.55
71 0.61
72 0.65
73 0.69
74 0.75
75 0.8
76 0.81
77 0.8
78 0.8
79 0.79
80 0.8
81 0.8
82 0.79
83 0.78
84 0.79
85 0.8
86 0.8
87 0.81
88 0.74
89 0.76
90 0.79
91 0.81
92 0.79
93 0.72