Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1L9PZG8

Protein Details
Accession A0A1L9PZG8   
Localization Confidence High
Confidence Score 20
NoLS Segment(s)
PositionSequenceProtein Nature
133-160GSPHRKRVGAQKDSPRRGRRRSPSYSSYHydrophilic
NLS Segment(s)
PositionSequence
52-83RSPPRVLSTRGKHGRQRHPPGRHADNRSPRHS
120-154PQGPRSFSSRSPSGSPHRKRVGAQKDSPRRGRRRS
Subcellular Location(s) nucl 25
Family & Domain DBs
InterPro View protein in InterPro  
IPR012677  Nucleotide-bd_a/b_plait_sf  
IPR035979  RBD_domain_sf  
Gene Ontology GO:0003676  F:nucleic acid binding  
Amino Acid Sequences MNHTFMANRGTAYILYHDPADAEAAIAHMHEAQLDGAVLNVSIVLPKRAFSRSPPRVLSTRGKHGRQRHPPGRHADNRSPRHSPYQQRASPPRAYGRARPMEGHDLYRPRSLSLSRSRSPQGPRSFSSRSPSGSPHRKRVGAQKDSPRRGRRRSPSYSSYDYSSRSRSRAHSRDRGRN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.15
3 0.15
4 0.14
5 0.13
6 0.13
7 0.13
8 0.09
9 0.08
10 0.06
11 0.07
12 0.07
13 0.06
14 0.06
15 0.05
16 0.05
17 0.05
18 0.05
19 0.05
20 0.05
21 0.05
22 0.05
23 0.05
24 0.05
25 0.04
26 0.04
27 0.04
28 0.03
29 0.05
30 0.06
31 0.08
32 0.08
33 0.1
34 0.13
35 0.16
36 0.17
37 0.23
38 0.34
39 0.39
40 0.45
41 0.47
42 0.48
43 0.48
44 0.53
45 0.55
46 0.49
47 0.52
48 0.53
49 0.56
50 0.59
51 0.66
52 0.7
53 0.72
54 0.77
55 0.76
56 0.75
57 0.76
58 0.77
59 0.76
60 0.73
61 0.7
62 0.68
63 0.69
64 0.68
65 0.66
66 0.62
67 0.55
68 0.55
69 0.55
70 0.53
71 0.51
72 0.55
73 0.53
74 0.57
75 0.61
76 0.58
77 0.54
78 0.49
79 0.44
80 0.41
81 0.4
82 0.38
83 0.41
84 0.41
85 0.39
86 0.38
87 0.37
88 0.37
89 0.36
90 0.33
91 0.29
92 0.27
93 0.29
94 0.31
95 0.28
96 0.22
97 0.23
98 0.22
99 0.25
100 0.31
101 0.36
102 0.34
103 0.38
104 0.4
105 0.44
106 0.48
107 0.5
108 0.49
109 0.47
110 0.47
111 0.5
112 0.52
113 0.49
114 0.49
115 0.44
116 0.39
117 0.36
118 0.4
119 0.43
120 0.49
121 0.52
122 0.56
123 0.59
124 0.59
125 0.6
126 0.65
127 0.66
128 0.64
129 0.66
130 0.68
131 0.72
132 0.77
133 0.84
134 0.83
135 0.82
136 0.82
137 0.84
138 0.84
139 0.83
140 0.84
141 0.82
142 0.8
143 0.78
144 0.75
145 0.68
146 0.61
147 0.55
148 0.5
149 0.46
150 0.46
151 0.43
152 0.4
153 0.43
154 0.47
155 0.54
156 0.6
157 0.65
158 0.68