Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1L9PU74

Protein Details
Accession A0A1L9PU74    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
57-81WDWIGLRPQRRGEKRRKGRGGVYYEBasic
NLS Segment(s)
PositionSequence
64-75PQRRGEKRRKGR
Subcellular Location(s) extr 15, mito 3, E.R. 3, plas 2, golg 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MLWISAVAPSLGFSGLCLFFLIFVGVAQDELQLDWRRGAGIANEARADTAHEAHWDWDWIGLRPQRRGEKRRKGRGGVYYEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.09
3 0.1
4 0.09
5 0.08
6 0.08
7 0.09
8 0.08
9 0.05
10 0.05
11 0.05
12 0.04
13 0.05
14 0.05
15 0.05
16 0.04
17 0.04
18 0.09
19 0.1
20 0.1
21 0.1
22 0.1
23 0.1
24 0.1
25 0.11
26 0.07
27 0.12
28 0.12
29 0.13
30 0.13
31 0.13
32 0.13
33 0.12
34 0.13
35 0.08
36 0.08
37 0.08
38 0.09
39 0.1
40 0.1
41 0.11
42 0.1
43 0.09
44 0.11
45 0.12
46 0.12
47 0.18
48 0.21
49 0.25
50 0.3
51 0.37
52 0.44
53 0.53
54 0.62
55 0.67
56 0.74
57 0.81
58 0.87
59 0.89
60 0.85
61 0.84
62 0.83