Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1L9P6T0

Protein Details
Accession A0A1L9P6T0   
Localization Confidence High
Confidence Score 22.1
NoLS Segment(s)
PositionSequenceProtein Nature
148-168AEKRRQAAEKKREQREFRAKDBasic
171-191AMARAKRPDQHGKRRLGRESQBasic
NLS Segment(s)
PositionSequence
5-29RPLEKAPSGKKPQPDATANKKRKGF
42-60RRKAQKIKADLIQKAKVKK
125-187RGGPGGRKNRKPKPSAFAKEMEIAEKRRQAAEKKREQREFRAKDREAMARAKRPDQHGKRRLG
Subcellular Location(s) nucl 21, cyto 3, mito 2
Family & Domain DBs
Amino Acid Sequences MVPKRPLEKAPSGKKPQPDATANKKRKGFSVGPANLPDGTYRRKAQKIKADLIQKAKVKKEYAKVKAAELAAPQPKQFYLRREEEERKDEDGKEQVAEPAGLELHPDRQAMVDSGEPAPEQVEGRGGPGGRKNRKPKPSAFAKEMEIAEKRRQAAEKKREQREFRAKDREAMARAKRPDQHGKRRLGRESQVLLSRVQRMVGESA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.77
3 0.74
4 0.71
5 0.68
6 0.67
7 0.69
8 0.75
9 0.75
10 0.74
11 0.72
12 0.66
13 0.63
14 0.62
15 0.55
16 0.53
17 0.56
18 0.53
19 0.52
20 0.52
21 0.49
22 0.41
23 0.37
24 0.31
25 0.24
26 0.24
27 0.25
28 0.28
29 0.34
30 0.42
31 0.48
32 0.54
33 0.6
34 0.64
35 0.64
36 0.66
37 0.66
38 0.63
39 0.63
40 0.62
41 0.56
42 0.54
43 0.53
44 0.52
45 0.49
46 0.5
47 0.53
48 0.56
49 0.57
50 0.59
51 0.55
52 0.51
53 0.51
54 0.45
55 0.37
56 0.28
57 0.28
58 0.26
59 0.25
60 0.24
61 0.2
62 0.2
63 0.23
64 0.25
65 0.23
66 0.25
67 0.3
68 0.35
69 0.41
70 0.48
71 0.49
72 0.5
73 0.48
74 0.45
75 0.43
76 0.38
77 0.33
78 0.29
79 0.24
80 0.2
81 0.18
82 0.14
83 0.12
84 0.12
85 0.09
86 0.06
87 0.06
88 0.05
89 0.05
90 0.05
91 0.06
92 0.08
93 0.08
94 0.07
95 0.08
96 0.08
97 0.08
98 0.09
99 0.07
100 0.08
101 0.08
102 0.08
103 0.08
104 0.07
105 0.07
106 0.07
107 0.06
108 0.05
109 0.07
110 0.06
111 0.07
112 0.09
113 0.09
114 0.1
115 0.16
116 0.25
117 0.32
118 0.41
119 0.49
120 0.57
121 0.66
122 0.7
123 0.7
124 0.69
125 0.72
126 0.7
127 0.65
128 0.58
129 0.52
130 0.52
131 0.46
132 0.41
133 0.33
134 0.3
135 0.31
136 0.32
137 0.3
138 0.29
139 0.33
140 0.39
141 0.46
142 0.53
143 0.59
144 0.65
145 0.74
146 0.79
147 0.8
148 0.82
149 0.82
150 0.79
151 0.78
152 0.78
153 0.7
154 0.66
155 0.66
156 0.62
157 0.55
158 0.56
159 0.54
160 0.51
161 0.54
162 0.55
163 0.56
164 0.58
165 0.65
166 0.66
167 0.7
168 0.71
169 0.77
170 0.8
171 0.83
172 0.82
173 0.79
174 0.75
175 0.72
176 0.68
177 0.64
178 0.61
179 0.54
180 0.49
181 0.45
182 0.44
183 0.36
184 0.33
185 0.27