Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1L9PFT8

Protein Details
Accession A0A1L9PFT8   
Localization Confidence Medium
Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
44-71DLSQKAKRAGKEKKKKSKSSRAGRSIYIHydrophilic
NLS Segment(s)
PositionSequence
48-67KAKRAGKEKKKKSKSSRAGR
Subcellular Location(s) mito 19, nucl 7.5, cyto_nucl 4.5
Family & Domain DBs
Amino Acid Sequences MTLCGRTCASTEVPPRRPKIRLINVVFLRTLSEIKLKRTDTTLDLSQKAKRAGKEKKKKSKSSRAGRSIYIG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.59
3 0.61
4 0.6
5 0.6
6 0.62
7 0.62
8 0.64
9 0.62
10 0.66
11 0.62
12 0.61
13 0.53
14 0.42
15 0.33
16 0.24
17 0.19
18 0.11
19 0.16
20 0.16
21 0.19
22 0.24
23 0.24
24 0.24
25 0.25
26 0.26
27 0.22
28 0.25
29 0.27
30 0.25
31 0.27
32 0.28
33 0.29
34 0.32
35 0.35
36 0.34
37 0.34
38 0.41
39 0.49
40 0.58
41 0.67
42 0.73
43 0.79
44 0.86
45 0.92
46 0.93
47 0.93
48 0.93
49 0.93
50 0.92
51 0.9
52 0.85