Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1L9P9C4

Protein Details
Accession A0A1L9P9C4    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
67-91ARDGPQVHKKRLRRHCRWGSFVRKKBasic
NLS Segment(s)
PositionSequence
75-80KKRLRR
Subcellular Location(s) plas 23, golg 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MVLDMIYLLFIIIILPYSISVSAGFAFCKVWYSLPTSEISSDSLCGVTSKMQDVRLTRVTVIIFQMARDGPQVHKKRLRRHCRWGSFVRKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.03
2 0.04
3 0.04
4 0.05
5 0.05
6 0.06
7 0.06
8 0.06
9 0.07
10 0.07
11 0.07
12 0.07
13 0.08
14 0.07
15 0.09
16 0.09
17 0.09
18 0.1
19 0.15
20 0.15
21 0.16
22 0.18
23 0.17
24 0.17
25 0.16
26 0.16
27 0.12
28 0.11
29 0.1
30 0.08
31 0.07
32 0.07
33 0.06
34 0.07
35 0.07
36 0.09
37 0.11
38 0.12
39 0.15
40 0.16
41 0.21
42 0.23
43 0.23
44 0.21
45 0.22
46 0.2
47 0.19
48 0.18
49 0.16
50 0.12
51 0.11
52 0.14
53 0.12
54 0.12
55 0.13
56 0.14
57 0.15
58 0.25
59 0.32
60 0.38
61 0.47
62 0.54
63 0.63
64 0.73
65 0.8
66 0.79
67 0.84
68 0.86
69 0.87
70 0.88
71 0.87