Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1L9PE57

Protein Details
Accession A0A1L9PE57    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-36MPRPKRKTKAEDLARIRRNQRNSRDRKKERVLELERBasic
NLS Segment(s)
PositionSequence
3-30RPKRKTKAEDLARIRRNQRNSRDRKKER
Subcellular Location(s) nucl 20.5, cyto_nucl 11.5, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR046347  bZIP_sf  
Gene Ontology GO:0003700  F:DNA-binding transcription factor activity  
CDD cd14688  bZIP_YAP  
Amino Acid Sequences MPRPKRKTKAEDLARIRRNQRNSRDRKKERVLELERRVEQLEAAATEASVQSLEHENRTLRGLLESVGFDGMSLNSYLHGPATASSSGHDLALAADSSEMQFMGLEVGPPTV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.81
3 0.78
4 0.75
5 0.75
6 0.74
7 0.76
8 0.76
9 0.8
10 0.84
11 0.87
12 0.88
13 0.88
14 0.88
15 0.86
16 0.82
17 0.81
18 0.78
19 0.77
20 0.76
21 0.73
22 0.64
23 0.57
24 0.51
25 0.4
26 0.32
27 0.23
28 0.16
29 0.09
30 0.09
31 0.07
32 0.06
33 0.06
34 0.06
35 0.05
36 0.04
37 0.04
38 0.04
39 0.08
40 0.09
41 0.1
42 0.11
43 0.12
44 0.12
45 0.14
46 0.13
47 0.09
48 0.1
49 0.09
50 0.08
51 0.09
52 0.08
53 0.07
54 0.07
55 0.06
56 0.05
57 0.06
58 0.05
59 0.05
60 0.05
61 0.05
62 0.05
63 0.06
64 0.06
65 0.05
66 0.06
67 0.05
68 0.05
69 0.09
70 0.09
71 0.09
72 0.1
73 0.12
74 0.12
75 0.12
76 0.11
77 0.08
78 0.07
79 0.09
80 0.08
81 0.06
82 0.06
83 0.06
84 0.06
85 0.07
86 0.06
87 0.05
88 0.05
89 0.05
90 0.07
91 0.07
92 0.08