Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1L9PTK3

Protein Details
Accession A0A1L9PTK3   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
49-70TCGYCGRRRRGTRGMHHRSRAVBasic
NLS Segment(s)
Subcellular Location(s) plas 11, extr 5, vacu 5, mito 4
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MGAVFSCIADLFRSIGACIMGVVNAIATGIKVVINGIVSVLGVLVSCLTCGYCGRRRRGTRGMHHRSRAVY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.1
3 0.09
4 0.08
5 0.08
6 0.07
7 0.05
8 0.05
9 0.05
10 0.04
11 0.03
12 0.03
13 0.03
14 0.02
15 0.03
16 0.03
17 0.03
18 0.03
19 0.03
20 0.03
21 0.04
22 0.04
23 0.04
24 0.03
25 0.03
26 0.03
27 0.03
28 0.02
29 0.02
30 0.02
31 0.03
32 0.03
33 0.03
34 0.03
35 0.03
36 0.04
37 0.06
38 0.12
39 0.2
40 0.28
41 0.35
42 0.46
43 0.52
44 0.59
45 0.67
46 0.7
47 0.74
48 0.78
49 0.81
50 0.81
51 0.81