FuNGI

A0A1L9PS77

Protein Details

Accession

A0A1L9PS77

Localization Confidence

High

Confidence Score

20.4

NoLS Segment(s)

Position	Sequence	Protein Nature
53-82	EAPSEEKPKKQKITLKKKKRPADEAAPNEP	Hydrophilic
259-278	APPLRWVRKRRFRDRVSTRT	Hydrophilic

NLS Segment(s)

Position	Sequence
35-77	PPAPQRKLTLKIARKPKEEAPSEEKPKKQKITLKKKKRPADEA
90-112	ASGPKRLKLNPSKKPGAQSIRIK

Subcellular Location(s)

nucl 21, cyto 4

Family & Domain DBs

InterPro	View protein in InterPro IPR037817 TAF7 IPR006751 TAFII55_prot_cons_reg
Gene Ontology	GO:0005669 C:transcription factor TFIID complex GO:0006367 P:transcription initiation at RNA polymerase II promoter
Pfam	View protein in Pfam PF04658 TAFII55_N
CDD	cd08047 TAF7

Amino Acid Sequences

MSDASRPSLKLTFGKKKAPEQPPSQPAPPPPSDQPPAPQRKLTLKIARKPKEEAPSEEKPKKQKITLKKKKRPADEAAPNEPSAAGASQASGPKRLKLNPSKKPGAQSIRIKNKGLVPNRPTGVGYDSEASDTEIDPAIEEQFILRMLPGEDCEYLRRAIDERRFDKSEFNFKPLTRDGRRSVLKVRDKQYAAVLVDLPCIIEGMKSWDKRGWYKSADICQMLLVLGPISAEAEAMDYPLPAEIQRPDDMALQYPHGLAPPLRWVRKRRFRDRVSTRTIEQVEKAVEDLIAQDDAAIGPPRYELVDKTSLDRAEGLVQSGEYDDYEYDDEQDAEGEVDEAMGEVDDMFGDLEDTLAAEMEAALAAEPGEDGTTLEAGVVEEAAESGVYQAGTPMATKPSTPAPDAGAGADTSGDESDGSNGEDETPEDELDEEQLEQQRLVQQSREEIAELEALIRTETAKWEMQKNQILKGKLAKRIQDLKTEVSLKKVSIGEGDDADS

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.61
2	0.63
3	0.7
4	0.76
5	0.78
6	0.77
7	0.74
8	0.78
9	0.77
10	0.78
11	0.72
12	0.67
13	0.64
14	0.63
15	0.59
16	0.55
17	0.52
18	0.53
19	0.54
20	0.51
21	0.53
22	0.56
23	0.62
24	0.6
25	0.58
26	0.56
27	0.6
28	0.64
29	0.66
30	0.66
31	0.65
32	0.69
33	0.76
34	0.8
35	0.75
36	0.74
37	0.72
38	0.71
39	0.67
40	0.66
41	0.63
42	0.65
43	0.7
44	0.72
45	0.71
46	0.7
47	0.74
48	0.73
49	0.74
50	0.73
51	0.74
52	0.78
53	0.83
54	0.85
55	0.86
56	0.89
57	0.9
58	0.9
59	0.87
60	0.85
61	0.84
62	0.83
63	0.8
64	0.78
65	0.71
66	0.62
67	0.53
68	0.44
69	0.33
70	0.24
71	0.17
72	0.1
73	0.07
74	0.08
75	0.11
76	0.15
77	0.16
78	0.21
79	0.22
80	0.26
81	0.32
82	0.36
83	0.43
84	0.5
85	0.6
86	0.63
87	0.71
88	0.74
89	0.72
90	0.72
91	0.71
92	0.68
93	0.67
94	0.67
95	0.68
96	0.72
97	0.73
98	0.69
99	0.63
100	0.63
101	0.62
102	0.59
103	0.58
104	0.52
105	0.55
106	0.54
107	0.52
108	0.44
109	0.37
110	0.33
111	0.24
112	0.21
113	0.16
114	0.15
115	0.15
116	0.14
117	0.13
118	0.12
119	0.1
120	0.1
121	0.09
122	0.08
123	0.08
124	0.09
125	0.08
126	0.07
127	0.07
128	0.06
129	0.06
130	0.06
131	0.06
132	0.05
133	0.05
134	0.06
135	0.07
136	0.08
137	0.1
138	0.11
139	0.12
140	0.13
141	0.14
142	0.14
143	0.13
144	0.14
145	0.14
146	0.2
147	0.27
148	0.34
149	0.36
150	0.42
151	0.45
152	0.44
153	0.49
154	0.47
155	0.5
156	0.43
157	0.44
158	0.42
159	0.39
160	0.44
161	0.42
162	0.46
163	0.39
164	0.44
165	0.43
166	0.47
167	0.5
168	0.47
169	0.5
170	0.51
171	0.55
172	0.56
173	0.57
174	0.56
175	0.54
176	0.52
177	0.47
178	0.42
179	0.34
180	0.27
181	0.25
182	0.17
183	0.17
184	0.15
185	0.13
186	0.07
187	0.07
188	0.06
189	0.04
190	0.04
191	0.11
192	0.17
193	0.17
194	0.19
195	0.21
196	0.24
197	0.29
198	0.33
199	0.32
200	0.28
201	0.33
202	0.37
203	0.4
204	0.4
205	0.35
206	0.31
207	0.25
208	0.23
209	0.17
210	0.13
211	0.08
212	0.04
213	0.04
214	0.03
215	0.03
216	0.03
217	0.03
218	0.03
219	0.03
220	0.03
221	0.03
222	0.04
223	0.04
224	0.04
225	0.04
226	0.04
227	0.04
228	0.04
229	0.05
230	0.06
231	0.09
232	0.1
233	0.1
234	0.11
235	0.13
236	0.14
237	0.14
238	0.14
239	0.12
240	0.12
241	0.11
242	0.1
243	0.08
244	0.08
245	0.06
246	0.06
247	0.14
248	0.19
249	0.23
250	0.29
251	0.35
252	0.45
253	0.56
254	0.64
255	0.67
256	0.72
257	0.73
258	0.79
259	0.82
260	0.8
261	0.77
262	0.71
263	0.61
264	0.57
265	0.54
266	0.44
267	0.35
268	0.29
269	0.22
270	0.19
271	0.18
272	0.11
273	0.09
274	0.08
275	0.07
276	0.06
277	0.05
278	0.05
279	0.04
280	0.04
281	0.04
282	0.05
283	0.06
284	0.05
285	0.05
286	0.06
287	0.06
288	0.07
289	0.08
290	0.07
291	0.12
292	0.18
293	0.18
294	0.21
295	0.24
296	0.23
297	0.23
298	0.22
299	0.18
300	0.15
301	0.15
302	0.13
303	0.1
304	0.09
305	0.09
306	0.09
307	0.09
308	0.05
309	0.06
310	0.05
311	0.06
312	0.07
313	0.07
314	0.08
315	0.09
316	0.09
317	0.08
318	0.08
319	0.07
320	0.06
321	0.06
322	0.05
323	0.04
324	0.04
325	0.04
326	0.03
327	0.03
328	0.03
329	0.03
330	0.02
331	0.02
332	0.02
333	0.03
334	0.03
335	0.03
336	0.03
337	0.03
338	0.03
339	0.03
340	0.03
341	0.03
342	0.03
343	0.03
344	0.03
345	0.03
346	0.03
347	0.03
348	0.03
349	0.03
350	0.03
351	0.03
352	0.03
353	0.03
354	0.03
355	0.03
356	0.03
357	0.03
358	0.04
359	0.04
360	0.04
361	0.04
362	0.04
363	0.04
364	0.04
365	0.04
366	0.03
367	0.03
368	0.03
369	0.03
370	0.03
371	0.03
372	0.03
373	0.04
374	0.04
375	0.04
376	0.05
377	0.05
378	0.06
379	0.06
380	0.08
381	0.1
382	0.11
383	0.11
384	0.13
385	0.2
386	0.23
387	0.24
388	0.23
389	0.23
390	0.25
391	0.25
392	0.23
393	0.17
394	0.14
395	0.12
396	0.11
397	0.08
398	0.07
399	0.06
400	0.06
401	0.05
402	0.05
403	0.07
404	0.08
405	0.08
406	0.08
407	0.08
408	0.09
409	0.09
410	0.09
411	0.1
412	0.11
413	0.1
414	0.1
415	0.1
416	0.1
417	0.1
418	0.11
419	0.09
420	0.11
421	0.16
422	0.16
423	0.16
424	0.17
425	0.22
426	0.25
427	0.27
428	0.27
429	0.24
430	0.28
431	0.31
432	0.3
433	0.25
434	0.22
435	0.21
436	0.19
437	0.16
438	0.13
439	0.11
440	0.1
441	0.1
442	0.09
443	0.09
444	0.09
445	0.12
446	0.15
447	0.19
448	0.23
449	0.3
450	0.36
451	0.44
452	0.5
453	0.5
454	0.55
455	0.57
456	0.55
457	0.53
458	0.56
459	0.55
460	0.57
461	0.6
462	0.58
463	0.6
464	0.68
465	0.67
466	0.66
467	0.63
468	0.59
469	0.6
470	0.61
471	0.53
472	0.49
473	0.48
474	0.39
475	0.41
476	0.38
477	0.31
478	0.28
479	0.3
480	0.26

A0A1L9PS77

3D AlphaFold-predicted Structure Viewer