Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1L9P3V0

Protein Details
Accession A0A1L9P3V0    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
83-108ISTGSPKKRKAAPRKKGDESPKKVKPBasic
NLS Segment(s)
PositionSequence
88-112PKKRKAAPRKKGDESPKKVKPEPKI
Subcellular Location(s) cyto 24, pero 2
Family & Domain DBs
Amino Acid Sequences MPMIWNADADAKLFLGVLNQVKDANVKLDCKKLADFMGPECIAGAVQNRLVRLRKKVEADMGGAVSVSPVADGVQTAGATSEISTGSPKKRKAAPRKKGDESPKKVKPEPKIKDEDEDMV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.07
3 0.11
4 0.14
5 0.14
6 0.14
7 0.15
8 0.15
9 0.17
10 0.17
11 0.17
12 0.16
13 0.2
14 0.22
15 0.28
16 0.28
17 0.29
18 0.29
19 0.27
20 0.26
21 0.25
22 0.23
23 0.19
24 0.24
25 0.22
26 0.2
27 0.18
28 0.16
29 0.12
30 0.12
31 0.12
32 0.06
33 0.09
34 0.1
35 0.11
36 0.14
37 0.19
38 0.21
39 0.26
40 0.3
41 0.32
42 0.34
43 0.35
44 0.36
45 0.33
46 0.31
47 0.26
48 0.2
49 0.15
50 0.12
51 0.1
52 0.06
53 0.05
54 0.03
55 0.02
56 0.02
57 0.02
58 0.02
59 0.03
60 0.03
61 0.04
62 0.04
63 0.04
64 0.04
65 0.04
66 0.04
67 0.05
68 0.05
69 0.05
70 0.05
71 0.08
72 0.11
73 0.19
74 0.26
75 0.29
76 0.34
77 0.42
78 0.52
79 0.62
80 0.69
81 0.72
82 0.76
83 0.83
84 0.84
85 0.85
86 0.86
87 0.85
88 0.83
89 0.83
90 0.8
91 0.78
92 0.78
93 0.77
94 0.76
95 0.76
96 0.76
97 0.74
98 0.75
99 0.71
100 0.71