Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1L9PZR0

Protein Details
Accession A0A1L9PZR0    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
27-52QPRSTSQHRKPPYPRRHLRPKAQVAAHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 17, nucl 9.5, cyto_nucl 5.5
Family & Domain DBs
Amino Acid Sequences MARRRRRSFKLIQMLPSTIPVSRYPPQPRSTSQHRKPPYPRRHLRPKAQVAANHEGTTLVQSLSKIRPPNRATYMSTIQTANKPCDPTSQDAQNSARTSKQQTK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.64
2 0.55
3 0.48
4 0.38
5 0.28
6 0.25
7 0.2
8 0.22
9 0.25
10 0.33
11 0.38
12 0.43
13 0.46
14 0.48
15 0.52
16 0.53
17 0.6
18 0.62
19 0.62
20 0.66
21 0.66
22 0.71
23 0.76
24 0.79
25 0.79
26 0.79
27 0.8
28 0.79
29 0.86
30 0.86
31 0.85
32 0.84
33 0.81
34 0.77
35 0.71
36 0.65
37 0.6
38 0.58
39 0.49
40 0.39
41 0.31
42 0.24
43 0.2
44 0.18
45 0.12
46 0.06
47 0.06
48 0.06
49 0.09
50 0.11
51 0.16
52 0.21
53 0.23
54 0.32
55 0.34
56 0.42
57 0.44
58 0.46
59 0.45
60 0.46
61 0.48
62 0.4
63 0.4
64 0.34
65 0.3
66 0.32
67 0.32
68 0.3
69 0.29
70 0.3
71 0.29
72 0.35
73 0.37
74 0.38
75 0.41
76 0.44
77 0.42
78 0.45
79 0.47
80 0.46
81 0.45
82 0.41
83 0.39
84 0.36