Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1L9PX24

Protein Details
Accession A0A1L9PX24    Localization Confidence High Confidence Score 16.8
NoLS Segment(s)
PositionSequenceProtein Nature
121-147DASMRKEKKRIQNRIAQKSFRKRKQDYHydrophilic
NLS Segment(s)
PositionSequence
125-144RKEKKRIQNRIAQKSFRKRK
Subcellular Location(s) nucl 23, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR004827  bZIP  
IPR046347  bZIP_sf  
Gene Ontology GO:0003700  F:DNA-binding transcription factor activity  
Pfam View protein in Pfam  
PF00170  bZIP_1  
PROSITE View protein in PROSITE  
PS50217  BZIP  
CDD cd14688  bZIP_YAP  
Amino Acid Sequences MDDVQLFATSPRQAYMPWATFSHSPEVSDNWSLRTSPGPVEPMQSLYPSLSRDSGFDLGQPNGHNSSIAYLNQDYIPYPDLALQSPDTSPSPSPEHVSDGLSSMPNNLPRRARNYKTTENDASMRKEKKRIQNRIAQKSFRKRKQDYVEALETRIRKLEAELEAHRRESFCFNGVVGASIQDDPVACQS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.27
3 0.27
4 0.27
5 0.28
6 0.3
7 0.32
8 0.34
9 0.35
10 0.27
11 0.25
12 0.24
13 0.26
14 0.27
15 0.29
16 0.27
17 0.23
18 0.24
19 0.22
20 0.22
21 0.22
22 0.2
23 0.18
24 0.2
25 0.21
26 0.2
27 0.23
28 0.22
29 0.23
30 0.22
31 0.2
32 0.17
33 0.15
34 0.16
35 0.15
36 0.16
37 0.14
38 0.14
39 0.14
40 0.17
41 0.18
42 0.16
43 0.16
44 0.17
45 0.16
46 0.18
47 0.17
48 0.16
49 0.15
50 0.15
51 0.13
52 0.11
53 0.12
54 0.13
55 0.12
56 0.13
57 0.11
58 0.12
59 0.12
60 0.12
61 0.11
62 0.1
63 0.11
64 0.08
65 0.08
66 0.1
67 0.1
68 0.1
69 0.11
70 0.1
71 0.1
72 0.1
73 0.11
74 0.1
75 0.11
76 0.11
77 0.12
78 0.15
79 0.15
80 0.17
81 0.16
82 0.18
83 0.17
84 0.18
85 0.15
86 0.13
87 0.13
88 0.11
89 0.1
90 0.09
91 0.1
92 0.15
93 0.17
94 0.2
95 0.23
96 0.26
97 0.35
98 0.41
99 0.43
100 0.46
101 0.51
102 0.57
103 0.58
104 0.63
105 0.56
106 0.51
107 0.51
108 0.46
109 0.43
110 0.41
111 0.43
112 0.39
113 0.46
114 0.5
115 0.57
116 0.64
117 0.69
118 0.69
119 0.72
120 0.79
121 0.82
122 0.81
123 0.78
124 0.77
125 0.78
126 0.82
127 0.81
128 0.81
129 0.74
130 0.78
131 0.8
132 0.79
133 0.75
134 0.72
135 0.71
136 0.62
137 0.59
138 0.53
139 0.45
140 0.37
141 0.32
142 0.25
143 0.17
144 0.18
145 0.22
146 0.21
147 0.26
148 0.3
149 0.35
150 0.37
151 0.39
152 0.38
153 0.33
154 0.32
155 0.31
156 0.29
157 0.24
158 0.22
159 0.2
160 0.22
161 0.21
162 0.2
163 0.15
164 0.13
165 0.13
166 0.12
167 0.12
168 0.1
169 0.1