Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1L9PEH5

Protein Details
Accession A0A1L9PEH5    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
118-152EEVRKKDEEKTEKNRKRREKRNKAKAGKKKNGGAGBasic
NLS Segment(s)
PositionSequence
120-151VRKKDEEKTEKNRKRREKRNKAKAGKKKNGGA
Subcellular Location(s) nucl 24.5, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR009548  Prkrip1  
Gene Ontology GO:0003725  F:double-stranded RNA binding  
Pfam View protein in Pfam  
PF06658  DUF1168  
Amino Acid Sequences MSEPGPSSIPTSADPRSQRPTKRRAVTPHGEQADAVASLFRDPSKEIRLPGTSNQKTASSLPAPPEIVANVQGSSAGAGSGEFHVYKASRRREYERLRLMQDEVDREKNQDDWQKKQEEVRKKDEEKTEKNRKRREKRNKAKAGKKKNGGAGKEDDVMDTTAEGRGPTNGSGGHGEGDQTEAAVETPGVIIHED
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.37
3 0.44
4 0.5
5 0.58
6 0.62
7 0.69
8 0.72
9 0.76
10 0.78
11 0.78
12 0.79
13 0.78
14 0.77
15 0.76
16 0.68
17 0.6
18 0.51
19 0.43
20 0.35
21 0.26
22 0.18
23 0.1
24 0.08
25 0.08
26 0.09
27 0.08
28 0.08
29 0.1
30 0.14
31 0.2
32 0.23
33 0.24
34 0.28
35 0.31
36 0.33
37 0.38
38 0.44
39 0.39
40 0.38
41 0.38
42 0.35
43 0.34
44 0.32
45 0.3
46 0.21
47 0.22
48 0.22
49 0.23
50 0.23
51 0.21
52 0.2
53 0.15
54 0.14
55 0.13
56 0.11
57 0.09
58 0.08
59 0.08
60 0.07
61 0.07
62 0.06
63 0.04
64 0.03
65 0.03
66 0.04
67 0.04
68 0.05
69 0.05
70 0.05
71 0.07
72 0.07
73 0.12
74 0.19
75 0.26
76 0.3
77 0.34
78 0.4
79 0.49
80 0.56
81 0.61
82 0.61
83 0.57
84 0.53
85 0.51
86 0.46
87 0.39
88 0.33
89 0.27
90 0.22
91 0.23
92 0.22
93 0.22
94 0.22
95 0.2
96 0.23
97 0.27
98 0.27
99 0.29
100 0.35
101 0.37
102 0.38
103 0.43
104 0.46
105 0.49
106 0.52
107 0.54
108 0.57
109 0.58
110 0.63
111 0.66
112 0.67
113 0.65
114 0.69
115 0.72
116 0.72
117 0.78
118 0.81
119 0.84
120 0.85
121 0.88
122 0.89
123 0.89
124 0.92
125 0.94
126 0.95
127 0.94
128 0.94
129 0.93
130 0.93
131 0.91
132 0.88
133 0.82
134 0.8
135 0.76
136 0.68
137 0.63
138 0.56
139 0.5
140 0.45
141 0.39
142 0.31
143 0.25
144 0.23
145 0.18
146 0.13
147 0.1
148 0.08
149 0.09
150 0.09
151 0.08
152 0.09
153 0.11
154 0.11
155 0.12
156 0.12
157 0.13
158 0.15
159 0.15
160 0.15
161 0.13
162 0.13
163 0.11
164 0.12
165 0.1
166 0.08
167 0.08
168 0.07
169 0.07
170 0.07
171 0.07
172 0.05
173 0.05
174 0.06