Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1J7IVK4

Protein Details
Accession A0A1J7IVK4    Localization Confidence Low Confidence Score 6.1
NoLS Segment(s)
PositionSequenceProtein Nature
57-82KSCTDPETPSRDKRKQKQGEVLEGSNHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 6, mito 5, E.R. 5, cyto_nucl 4, nucl 3.5, cyto 3.5, pero 2, golg 2
Family & Domain DBs
Amino Acid Sequences MTEMRVNIVLYTLSATVIPSMIPLCHLFGCVVVPVEHVRPPERAGGFLRHKLSMPRKSCTDPETPSRDKRKQKQGEVLEGSN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.08
3 0.07
4 0.07
5 0.06
6 0.06
7 0.06
8 0.06
9 0.07
10 0.08
11 0.09
12 0.09
13 0.1
14 0.09
15 0.09
16 0.09
17 0.08
18 0.08
19 0.06
20 0.07
21 0.08
22 0.09
23 0.11
24 0.12
25 0.13
26 0.13
27 0.14
28 0.18
29 0.17
30 0.18
31 0.18
32 0.24
33 0.27
34 0.31
35 0.31
36 0.28
37 0.28
38 0.34
39 0.41
40 0.43
41 0.43
42 0.42
43 0.45
44 0.48
45 0.51
46 0.48
47 0.46
48 0.41
49 0.45
50 0.49
51 0.51
52 0.56
53 0.63
54 0.68
55 0.71
56 0.77
57 0.8
58 0.82
59 0.85
60 0.86
61 0.84
62 0.85