Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1J7IYX5

Protein Details
Accession A0A1J7IYX5    Localization Confidence Medium Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
6-32HKVNNIPKTKPTKKTQSQRKAPLTPSFHydrophilic
NLS Segment(s)
PositionSequence
116-128PRTRSRRAGSRHG
Subcellular Location(s) mito 16, nucl 9, cyto_nucl 6.5
Family & Domain DBs
Amino Acid Sequences MLILSHKVNNIPKTKPTKKTQSQRKAPLTPSFQTLSLTQSSTSPHPSQHHLHPFPSPPFSCLKTPSLTQQSTHPLTPLANILIPTKNTSGPLKYSGANTFAATKHSGKGEPGAMSPRTRSRRAGSRHGTRVER
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.64
2 0.67
3 0.69
4 0.73
5 0.78
6 0.84
7 0.87
8 0.87
9 0.88
10 0.9
11 0.89
12 0.85
13 0.8
14 0.78
15 0.73
16 0.63
17 0.57
18 0.49
19 0.4
20 0.35
21 0.3
22 0.24
23 0.2
24 0.19
25 0.15
26 0.14
27 0.16
28 0.16
29 0.21
30 0.19
31 0.22
32 0.24
33 0.28
34 0.31
35 0.37
36 0.45
37 0.41
38 0.42
39 0.4
40 0.42
41 0.39
42 0.41
43 0.33
44 0.25
45 0.26
46 0.27
47 0.26
48 0.25
49 0.25
50 0.21
51 0.22
52 0.26
53 0.3
54 0.28
55 0.26
56 0.27
57 0.3
58 0.31
59 0.3
60 0.24
61 0.18
62 0.18
63 0.18
64 0.15
65 0.1
66 0.08
67 0.09
68 0.1
69 0.11
70 0.12
71 0.13
72 0.14
73 0.14
74 0.16
75 0.17
76 0.17
77 0.18
78 0.21
79 0.21
80 0.21
81 0.23
82 0.22
83 0.22
84 0.21
85 0.2
86 0.19
87 0.17
88 0.18
89 0.19
90 0.19
91 0.19
92 0.2
93 0.21
94 0.19
95 0.22
96 0.23
97 0.21
98 0.22
99 0.25
100 0.25
101 0.26
102 0.3
103 0.36
104 0.39
105 0.42
106 0.45
107 0.48
108 0.55
109 0.6
110 0.66
111 0.67
112 0.7
113 0.75