Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1J7JRE4

Protein Details
Accession A0A1J7JRE4    Localization Confidence Medium Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-25MPRKRKSLTRKKRKNKNTAEEGQIWHydrophilic
NLS Segment(s)
PositionSequence
3-16RKRKSLTRKKRKNK
Subcellular Location(s) nucl 15, cyto 6.5, cyto_mito 6.5, mito 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR016197  Chromo-like_dom_sf  
Amino Acid Sequences MPRKRKSLTRKKRKNKNTAEEGQIWEVRGILDERTSAKGVLEYLVDWAPDKTTGKEYDPEWVRRAFLQAP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.95
2 0.94
3 0.93
4 0.91
5 0.86
6 0.81
7 0.74
8 0.66
9 0.58
10 0.48
11 0.38
12 0.29
13 0.22
14 0.16
15 0.13
16 0.11
17 0.07
18 0.07
19 0.07
20 0.09
21 0.11
22 0.11
23 0.1
24 0.09
25 0.1
26 0.09
27 0.09
28 0.08
29 0.06
30 0.07
31 0.08
32 0.08
33 0.08
34 0.08
35 0.08
36 0.1
37 0.12
38 0.12
39 0.17
40 0.19
41 0.22
42 0.25
43 0.25
44 0.32
45 0.37
46 0.39
47 0.38
48 0.37
49 0.35
50 0.33