Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1J7I4R0

Protein Details
Accession A0A1J7I4R0    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
58-82QAYRDCKKEWLEKRRLERRKEGKFFBasic
NLS Segment(s)
PositionSequence
70-78KRRLERRKE
Subcellular Location(s) nucl 13.5, cyto_nucl 12, cyto 9.5, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR009069  Cys_alpha_HP_mot_SF  
PROSITE View protein in PROSITE  
PS51808  CHCH  
Amino Acid Sequences MATAGDDEKGPWNKETKAKFESKDRSQWLDPCQAAAERSIRCLHRNGGDRALCTDYFQAYRDCKKEWLEKRRLERRKEGKFF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.45
3 0.44
4 0.46
5 0.5
6 0.51
7 0.56
8 0.61
9 0.59
10 0.63
11 0.6
12 0.59
13 0.56
14 0.57
15 0.52
16 0.5
17 0.43
18 0.35
19 0.32
20 0.26
21 0.23
22 0.21
23 0.21
24 0.13
25 0.16
26 0.19
27 0.19
28 0.2
29 0.21
30 0.22
31 0.24
32 0.3
33 0.3
34 0.34
35 0.34
36 0.33
37 0.34
38 0.34
39 0.27
40 0.23
41 0.21
42 0.16
43 0.16
44 0.16
45 0.18
46 0.2
47 0.27
48 0.28
49 0.3
50 0.32
51 0.37
52 0.46
53 0.52
54 0.58
55 0.61
56 0.67
57 0.76
58 0.82
59 0.85
60 0.83
61 0.84
62 0.84