Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1J7ICA9

Protein Details
Accession A0A1J7ICA9    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
63-85YLPYSLRRRRSLQRAHPLRDRSSHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 11, extr 8, E.R. 3, golg 3
Family & Domain DBs
Amino Acid Sequences MVITMWDSVALIDVLCLAFAGFSWDYVLCPKVTAYFWRTLSSPPDIKIEQVLEEGDGNRHTHYLPYSLRRRRSLQRAHPLRDRSS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.05
3 0.05
4 0.03
5 0.03
6 0.03
7 0.08
8 0.07
9 0.08
10 0.09
11 0.09
12 0.1
13 0.12
14 0.13
15 0.08
16 0.09
17 0.09
18 0.1
19 0.11
20 0.14
21 0.16
22 0.21
23 0.22
24 0.23
25 0.23
26 0.23
27 0.25
28 0.25
29 0.23
30 0.19
31 0.21
32 0.2
33 0.2
34 0.2
35 0.17
36 0.13
37 0.13
38 0.11
39 0.08
40 0.09
41 0.09
42 0.09
43 0.09
44 0.09
45 0.09
46 0.1
47 0.1
48 0.11
49 0.12
50 0.17
51 0.2
52 0.29
53 0.38
54 0.46
55 0.53
56 0.57
57 0.62
58 0.66
59 0.72
60 0.74
61 0.75
62 0.78
63 0.8
64 0.82
65 0.84