Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1J7J609

Protein Details
Accession A0A1J7J609    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
30-55ESQPKNESKPKRSLRQRLKKSLKEIGHydrophilic
NLS Segment(s)
PositionSequence
37-49SKPKRSLRQRLKK
Subcellular Location(s) nucl 22, cyto_nucl 12.833, mito_nucl 12.833
Family & Domain DBs
Amino Acid Sequences MASQQQQQPSSYAKSTYSESTTFSYSKPSESQPKNESKPKRSLRQRLKKSLKEIGYPPTYHHDVLNGKNRPEYGIYGDSVFTDKRTFVLAEKVMSTIKGWIMSIGRSTPKTCIAH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.29
3 0.3
4 0.29
5 0.25
6 0.25
7 0.26
8 0.27
9 0.26
10 0.23
11 0.26
12 0.23
13 0.25
14 0.25
15 0.28
16 0.35
17 0.39
18 0.46
19 0.46
20 0.55
21 0.58
22 0.64
23 0.67
24 0.63
25 0.69
26 0.7
27 0.73
28 0.74
29 0.78
30 0.81
31 0.83
32 0.86
33 0.87
34 0.89
35 0.84
36 0.8
37 0.77
38 0.69
39 0.61
40 0.54
41 0.49
42 0.43
43 0.37
44 0.32
45 0.29
46 0.29
47 0.25
48 0.23
49 0.21
50 0.21
51 0.26
52 0.34
53 0.32
54 0.31
55 0.32
56 0.32
57 0.29
58 0.27
59 0.23
60 0.19
61 0.17
62 0.17
63 0.17
64 0.17
65 0.16
66 0.16
67 0.14
68 0.1
69 0.1
70 0.09
71 0.09
72 0.11
73 0.12
74 0.12
75 0.19
76 0.19
77 0.2
78 0.2
79 0.21
80 0.19
81 0.19
82 0.18
83 0.13
84 0.13
85 0.12
86 0.12
87 0.13
88 0.14
89 0.15
90 0.17
91 0.19
92 0.23
93 0.25
94 0.26
95 0.27