Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1J7I9A2

Protein Details
Accession A0A1J7I9A2    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
80-99PWLERRCHPGWRSRPRRLPRBasic
NLS Segment(s)
PositionSequence
91-99RSRPRRLPR
Subcellular Location(s) mito 22.5, mito_nucl 12, cyto 2, plas 2
Family & Domain DBs
Amino Acid Sequences MAPKLICIESKRRRLSSGRCMWWRFAMLLVVQQQIRVCCGSIAAWSSLPAVRCSCIFCRGTSIMVRKNRHAGKATMLIGPWLERRCHPGWRSRPRRLPR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.64
2 0.69
3 0.69
4 0.69
5 0.69
6 0.69
7 0.69
8 0.66
9 0.6
10 0.53
11 0.42
12 0.33
13 0.25
14 0.18
15 0.19
16 0.18
17 0.18
18 0.16
19 0.17
20 0.17
21 0.15
22 0.16
23 0.13
24 0.11
25 0.08
26 0.09
27 0.08
28 0.08
29 0.09
30 0.08
31 0.08
32 0.08
33 0.09
34 0.1
35 0.1
36 0.1
37 0.09
38 0.09
39 0.1
40 0.12
41 0.13
42 0.17
43 0.18
44 0.16
45 0.21
46 0.21
47 0.23
48 0.25
49 0.29
50 0.3
51 0.38
52 0.4
53 0.39
54 0.47
55 0.48
56 0.48
57 0.47
58 0.41
59 0.39
60 0.43
61 0.41
62 0.34
63 0.3
64 0.26
65 0.22
66 0.23
67 0.22
68 0.18
69 0.19
70 0.19
71 0.26
72 0.28
73 0.37
74 0.4
75 0.45
76 0.53
77 0.63
78 0.72
79 0.76