Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1J7JEI5

Protein Details
Accession A0A1J7JEI5   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
41-60IVGKSDRKNRTPRQTRWSTCHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 10.5, cyto_nucl 8.5, extr 6, cyto 5.5, mito 5
Family & Domain DBs
Amino Acid Sequences MHSLLPFSLKASSIACSEVEASDCTNYTNGGTSRSDLTTWIVGKSDRKNRTPRQTRWSTCSLLPLQRDLGCRH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.13
3 0.13
4 0.13
5 0.12
6 0.12
7 0.11
8 0.11
9 0.1
10 0.1
11 0.1
12 0.09
13 0.09
14 0.08
15 0.11
16 0.1
17 0.12
18 0.13
19 0.13
20 0.15
21 0.15
22 0.15
23 0.12
24 0.13
25 0.13
26 0.12
27 0.12
28 0.11
29 0.12
30 0.17
31 0.24
32 0.32
33 0.36
34 0.42
35 0.51
36 0.6
37 0.7
38 0.75
39 0.75
40 0.76
41 0.81
42 0.79
43 0.76
44 0.72
45 0.64
46 0.55
47 0.54
48 0.49
49 0.45
50 0.42
51 0.39
52 0.38
53 0.38