Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C0NBJ0

Protein Details
Accession C0NBJ0    Localization Confidence Medium Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MTQEHPPRRQRRRYKPQRLRAPAEVVHydrophilic
NLS Segment(s)
PositionSequence
8-18RRQRRRYKPQR
Subcellular Location(s) mito 14, nucl 8.5, cyto_nucl 7, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MTQEHPPRRQRRRYKPQRLRAPAEVVTEDREKLAARQATRKNRLSQPPLLAPRPPCLPDYYWRRGTYSAGAHWSGLTALQLLWPLTDSSAKGRRLTNRYAARGT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.95
2 0.95
3 0.95
4 0.96
5 0.93
6 0.89
7 0.84
8 0.78
9 0.7
10 0.62
11 0.54
12 0.43
13 0.38
14 0.32
15 0.26
16 0.2
17 0.17
18 0.14
19 0.13
20 0.19
21 0.19
22 0.2
23 0.29
24 0.37
25 0.47
26 0.54
27 0.58
28 0.57
29 0.6
30 0.66
31 0.63
32 0.59
33 0.53
34 0.53
35 0.52
36 0.48
37 0.43
38 0.36
39 0.33
40 0.31
41 0.28
42 0.22
43 0.2
44 0.21
45 0.25
46 0.32
47 0.36
48 0.4
49 0.39
50 0.4
51 0.39
52 0.39
53 0.36
54 0.3
55 0.26
56 0.23
57 0.23
58 0.21
59 0.2
60 0.18
61 0.13
62 0.1
63 0.08
64 0.05
65 0.05
66 0.05
67 0.07
68 0.06
69 0.06
70 0.07
71 0.07
72 0.08
73 0.1
74 0.1
75 0.17
76 0.24
77 0.27
78 0.3
79 0.36
80 0.44
81 0.49
82 0.54
83 0.57
84 0.59