Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1J7I6Z0

Protein Details
Accession A0A1J7I6Z0   
Localization Confidence Low
Confidence Score 6.1
NoLS Segment(s)
PositionSequenceProtein Nature
109-130QYDNRCVRKRLRYRIHLPLTRAHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 11.5, cyto_nucl 8, mito 5, pero 4, nucl 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002429  CcO_II-like_C  
IPR008972  Cupredoxin  
Gene Ontology GO:0016020  C:membrane  
GO:0005507  F:copper ion binding  
GO:0004129  F:cytochrome-c oxidase activity  
PROSITE View protein in PROSITE  
PS50857  COX2_CUA  
Amino Acid Sequences MDLFYVSAIAGQIYVMPGMETKMHTVIHMAGRPPAAMTGVSANFNVAGVSHMIFQYHGLDHKGFDGWVTDVKLQRAALNRDVHLRLKSPATWSGRAPTMESAENCEKMQYDNRCVRKRLRYRIHLPLTRAGRRTPITTTVAGR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.05
3 0.05
4 0.05
5 0.07
6 0.08
7 0.09
8 0.11
9 0.13
10 0.13
11 0.13
12 0.14
13 0.17
14 0.2
15 0.22
16 0.2
17 0.2
18 0.2
19 0.2
20 0.19
21 0.16
22 0.12
23 0.09
24 0.09
25 0.1
26 0.11
27 0.12
28 0.11
29 0.11
30 0.1
31 0.1
32 0.09
33 0.05
34 0.05
35 0.05
36 0.05
37 0.06
38 0.06
39 0.06
40 0.07
41 0.07
42 0.08
43 0.08
44 0.09
45 0.09
46 0.1
47 0.1
48 0.11
49 0.1
50 0.09
51 0.08
52 0.08
53 0.07
54 0.08
55 0.09
56 0.11
57 0.12
58 0.12
59 0.14
60 0.13
61 0.15
62 0.18
63 0.2
64 0.24
65 0.25
66 0.25
67 0.28
68 0.3
69 0.3
70 0.26
71 0.24
72 0.2
73 0.2
74 0.21
75 0.2
76 0.25
77 0.27
78 0.28
79 0.27
80 0.29
81 0.3
82 0.29
83 0.28
84 0.23
85 0.21
86 0.22
87 0.21
88 0.25
89 0.25
90 0.26
91 0.24
92 0.23
93 0.21
94 0.2
95 0.28
96 0.27
97 0.32
98 0.39
99 0.48
100 0.54
101 0.58
102 0.63
103 0.66
104 0.71
105 0.74
106 0.76
107 0.76
108 0.78
109 0.84
110 0.86
111 0.81
112 0.74
113 0.72
114 0.7
115 0.67
116 0.62
117 0.53
118 0.51
119 0.49
120 0.48
121 0.44
122 0.41
123 0.39