Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1J7JUU7

Protein Details
Accession A0A1J7JUU7    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
16-41LWKIPWRLSKFQKARQRRRLRAVDSVHydrophilic
76-105DKYTIFDRKEKKYRKGIHKLPKWTRVSQRVHydrophilic
NLS Segment(s)
PositionSequence
84-96KEKKYRKGIHKLP
Subcellular Location(s) mito 20.5, mito_nucl 12.833, nucl 4, cyto_nucl 3.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MFGPFRITNPLSGGLLWKIPWRLSKFQKARQRRRLRAVDSVVATLYSALSKQGQTLESLERWKAEMPTEQEMLPKDKYTIFDRKEKKYRKGIHKLPKWTRVSQRVNPPGY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.17
3 0.16
4 0.17
5 0.17
6 0.19
7 0.26
8 0.3
9 0.38
10 0.44
11 0.54
12 0.59
13 0.66
14 0.74
15 0.78
16 0.83
17 0.85
18 0.89
19 0.86
20 0.88
21 0.87
22 0.82
23 0.79
24 0.72
25 0.66
26 0.55
27 0.47
28 0.37
29 0.28
30 0.23
31 0.14
32 0.1
33 0.05
34 0.04
35 0.04
36 0.05
37 0.06
38 0.06
39 0.08
40 0.08
41 0.09
42 0.11
43 0.12
44 0.12
45 0.14
46 0.13
47 0.12
48 0.13
49 0.13
50 0.12
51 0.12
52 0.15
53 0.18
54 0.21
55 0.22
56 0.21
57 0.22
58 0.23
59 0.25
60 0.21
61 0.18
62 0.16
63 0.17
64 0.2
65 0.24
66 0.31
67 0.31
68 0.4
69 0.46
70 0.54
71 0.63
72 0.69
73 0.71
74 0.73
75 0.79
76 0.81
77 0.85
78 0.85
79 0.86
80 0.86
81 0.89
82 0.88
83 0.88
84 0.83
85 0.8
86 0.8
87 0.8
88 0.8
89 0.77
90 0.79