Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1J7J262

Protein Details
Accession A0A1J7J262    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
14-45VKSQTPKVEKQEKPKRPKGRAHKREQYTRRFVBasic
NLS Segment(s)
PositionSequence
12-37GKVKSQTPKVEKQEKPKRPKGRAHKR
Subcellular Location(s) nucl 11.5, mito 10, cyto_nucl 9, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR006846  Ribosomal_S30  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF04758  Ribosomal_S30  
Amino Acid Sequences MGKVHGSLARAGKVKSQTPKVEKQEKPKRPKGRAHKREQYTRRFVNVTLAPGGKRKMNPNPTT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.41
3 0.46
4 0.49
5 0.53
6 0.62
7 0.65
8 0.7
9 0.69
10 0.72
11 0.76
12 0.77
13 0.8
14 0.8
15 0.81
16 0.79
17 0.83
18 0.83
19 0.84
20 0.84
21 0.85
22 0.85
23 0.82
24 0.85
25 0.84
26 0.81
27 0.79
28 0.72
29 0.67
30 0.59
31 0.52
32 0.49
33 0.43
34 0.37
35 0.32
36 0.3
37 0.27
38 0.29
39 0.31
40 0.28
41 0.3
42 0.36
43 0.43