Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C0P049

Protein Details
Accession C0P049    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
81-105SAENMGRIRKRVRRKTRPSITFAARHydrophilic
NLS Segment(s)
PositionSequence
86-116GRIRKRVRRKTRPSITFAARPQKVKRVNKRK
Subcellular Location(s) mito 16, nucl 8, cyto_nucl 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR019434  DUF2423  
Pfam View protein in Pfam  
PF10338  DUF2423  
Amino Acid Sequences MAKGLRSSVMKRNKAKLRAEVFVPIVDRRTERLSTKLQELVAKPKGVNMNDADKLDMNKTEESGAGKEMDIDVQPGATKPSAENMGRIRKRVRRKTRPSITFAARPQKVKRVNKRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.73
2 0.75
3 0.75
4 0.7
5 0.65
6 0.6
7 0.54
8 0.46
9 0.4
10 0.35
11 0.27
12 0.23
13 0.21
14 0.2
15 0.19
16 0.22
17 0.23
18 0.24
19 0.28
20 0.32
21 0.33
22 0.36
23 0.35
24 0.32
25 0.33
26 0.33
27 0.35
28 0.33
29 0.31
30 0.27
31 0.28
32 0.32
33 0.28
34 0.29
35 0.23
36 0.25
37 0.25
38 0.26
39 0.23
40 0.18
41 0.19
42 0.16
43 0.15
44 0.12
45 0.11
46 0.11
47 0.1
48 0.11
49 0.11
50 0.11
51 0.1
52 0.09
53 0.08
54 0.08
55 0.08
56 0.08
57 0.06
58 0.07
59 0.05
60 0.05
61 0.05
62 0.06
63 0.07
64 0.07
65 0.07
66 0.07
67 0.1
68 0.16
69 0.16
70 0.2
71 0.25
72 0.36
73 0.38
74 0.42
75 0.47
76 0.5
77 0.61
78 0.67
79 0.72
80 0.73
81 0.81
82 0.88
83 0.91
84 0.9
85 0.85
86 0.83
87 0.78
88 0.75
89 0.72
90 0.71
91 0.65
92 0.64
93 0.63
94 0.64
95 0.68
96 0.71