Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1J7J5K4

Protein Details
Accession A0A1J7J5K4    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
72-95GGVSKGRRRMRPSLNKNTRSRTEGHydrophilic
NLS Segment(s)
PositionSequence
76-83KGRRRMRP
Subcellular Location(s) extr 9, nucl 8, mito 8, mito_nucl 8
Family & Domain DBs
Amino Acid Sequences MPPPALSGLSGHCSWALLGPFRTIIIAALAASSCESASTQQEDSGKMENVDGWLGRRQQRLQACMRRGCGPGGVSKGRRRMRPSLNKNTRSRTEG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.16
3 0.15
4 0.15
5 0.15
6 0.16
7 0.16
8 0.16
9 0.16
10 0.12
11 0.1
12 0.07
13 0.07
14 0.05
15 0.05
16 0.05
17 0.05
18 0.05
19 0.05
20 0.04
21 0.04
22 0.04
23 0.06
24 0.08
25 0.1
26 0.1
27 0.12
28 0.13
29 0.14
30 0.16
31 0.17
32 0.15
33 0.13
34 0.12
35 0.11
36 0.1
37 0.09
38 0.08
39 0.07
40 0.1
41 0.14
42 0.19
43 0.22
44 0.23
45 0.29
46 0.34
47 0.37
48 0.43
49 0.48
50 0.5
51 0.51
52 0.52
53 0.49
54 0.46
55 0.42
56 0.36
57 0.28
58 0.26
59 0.28
60 0.32
61 0.34
62 0.39
63 0.48
64 0.51
65 0.57
66 0.59
67 0.63
68 0.68
69 0.73
70 0.77
71 0.79
72 0.84
73 0.86
74 0.88
75 0.87