Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1J7J8K4

Protein Details
Accession A0A1J7J8K4    Localization Confidence Medium Confidence Score 14
NoLS Segment(s)
PositionSequenceProtein Nature
97-117AVKNWWNGNQNRRKRMDRRKTHydrophilic
NLS Segment(s)
PositionSequence
108-116RRKRMDRRK
Subcellular Location(s) nucl 22, cyto_nucl 12.5, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR009057  Homeobox-like_sf  
IPR017930  Myb_dom  
IPR001005  SANT/Myb  
Pfam View protein in Pfam  
PF13921  Myb_DNA-bind_6  
PROSITE View protein in PROSITE  
PS51294  HTH_MYB  
PS50090  MYB_LIKE  
CDD cd00167  SANT  
Amino Acid Sequences MASIEHQRRGPWSHREDGLLMRLVATQGALNWVRISQQLGTRTPKQCRERYHQNLKPNLNHEPISQEEGLVIEQLVREIGKRWAEIARRLNNRSDNAVKNWWNGNQNRRKRMDRRKT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.5
3 0.48
4 0.45
5 0.41
6 0.34
7 0.27
8 0.21
9 0.2
10 0.17
11 0.15
12 0.12
13 0.08
14 0.05
15 0.1
16 0.1
17 0.11
18 0.11
19 0.11
20 0.11
21 0.12
22 0.14
23 0.11
24 0.15
25 0.19
26 0.23
27 0.29
28 0.35
29 0.4
30 0.44
31 0.51
32 0.54
33 0.57
34 0.59
35 0.62
36 0.66
37 0.7
38 0.75
39 0.71
40 0.71
41 0.73
42 0.71
43 0.66
44 0.58
45 0.53
46 0.45
47 0.4
48 0.32
49 0.27
50 0.24
51 0.24
52 0.2
53 0.16
54 0.13
55 0.12
56 0.12
57 0.09
58 0.07
59 0.04
60 0.04
61 0.04
62 0.04
63 0.04
64 0.04
65 0.06
66 0.11
67 0.13
68 0.13
69 0.15
70 0.2
71 0.24
72 0.32
73 0.39
74 0.43
75 0.49
76 0.51
77 0.56
78 0.56
79 0.55
80 0.54
81 0.53
82 0.48
83 0.46
84 0.51
85 0.47
86 0.46
87 0.47
88 0.46
89 0.47
90 0.49
91 0.55
92 0.58
93 0.65
94 0.71
95 0.74
96 0.79
97 0.81