Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1J7JUN3

Protein Details
Accession A0A1J7JUN3   
Localization Confidence Medium
Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
114-137PPPFPSPPRRWQARRPPCSRRAAAHydrophilic
NLS Segment(s)
PositionSequence
118-148PSPPRRWQARRPPCSRRAAAPPRSGSRPPRT
Subcellular Location(s) nucl 16, cyto_nucl 10.5, mito 8
Family & Domain DBs
Amino Acid Sequences MPPKTPSPTQTSRPNPSTTPSQQAPLTTSTPSYHPYPQPQAPSPPSSTPPQENYAHDPHPARPLSPSQTSHHLPSPSPPSPARQEKTRYYPPLSSSSQAAAPPRQARCSTPSRPPPFPSPPRRWQARRPPCSRRAAAPPRSGSRPPRTWRPPGSCPPLIPPVHCW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.66
2 0.59
3 0.56
4 0.58
5 0.52
6 0.51
7 0.44
8 0.44
9 0.41
10 0.4
11 0.38
12 0.33
13 0.3
14 0.23
15 0.23
16 0.2
17 0.21
18 0.22
19 0.24
20 0.26
21 0.29
22 0.35
23 0.4
24 0.43
25 0.47
26 0.47
27 0.51
28 0.49
29 0.49
30 0.46
31 0.41
32 0.4
33 0.38
34 0.39
35 0.36
36 0.36
37 0.36
38 0.35
39 0.35
40 0.38
41 0.39
42 0.36
43 0.34
44 0.32
45 0.29
46 0.33
47 0.3
48 0.25
49 0.23
50 0.26
51 0.28
52 0.31
53 0.32
54 0.27
55 0.33
56 0.35
57 0.34
58 0.35
59 0.31
60 0.26
61 0.27
62 0.32
63 0.28
64 0.29
65 0.27
66 0.26
67 0.32
68 0.4
69 0.38
70 0.37
71 0.41
72 0.42
73 0.49
74 0.53
75 0.51
76 0.47
77 0.47
78 0.44
79 0.44
80 0.41
81 0.35
82 0.28
83 0.24
84 0.22
85 0.21
86 0.21
87 0.16
88 0.19
89 0.24
90 0.24
91 0.27
92 0.27
93 0.28
94 0.31
95 0.38
96 0.37
97 0.41
98 0.5
99 0.53
100 0.56
101 0.58
102 0.6
103 0.62
104 0.67
105 0.68
106 0.66
107 0.68
108 0.72
109 0.78
110 0.76
111 0.77
112 0.78
113 0.79
114 0.81
115 0.81
116 0.83
117 0.82
118 0.84
119 0.77
120 0.72
121 0.72
122 0.72
123 0.71
124 0.7
125 0.68
126 0.65
127 0.68
128 0.68
129 0.66
130 0.66
131 0.67
132 0.65
133 0.69
134 0.71
135 0.75
136 0.78
137 0.78
138 0.77
139 0.78
140 0.79
141 0.73
142 0.67
143 0.64
144 0.63
145 0.56