Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1J7IRE7

Protein Details
Accession A0A1J7IRE7    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
66-89KAKKATTSRLPKFTKKRVASPPSPHydrophilic
NLS Segment(s)
PositionSequence
68-69KK
73-82SRLPKFTKKR
Subcellular Location(s) mito 15, nucl 10.5, cyto_nucl 6.5
Family & Domain DBs
Amino Acid Sequences MTTIIRTARQPLSVLSMGNEPTRRKSKRLAVSYDEKDGDFVFTRAAKKAKTVPLEPENEEPLAPVKAKKATTSRLPKFTKKRVASPPSP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.21
3 0.21
4 0.21
5 0.24
6 0.27
7 0.22
8 0.28
9 0.38
10 0.39
11 0.4
12 0.47
13 0.53
14 0.58
15 0.63
16 0.62
17 0.58
18 0.64
19 0.63
20 0.58
21 0.5
22 0.39
23 0.33
24 0.27
25 0.22
26 0.14
27 0.12
28 0.09
29 0.11
30 0.12
31 0.14
32 0.16
33 0.14
34 0.16
35 0.22
36 0.27
37 0.29
38 0.3
39 0.34
40 0.38
41 0.41
42 0.41
43 0.38
44 0.34
45 0.3
46 0.28
47 0.21
48 0.17
49 0.16
50 0.14
51 0.12
52 0.14
53 0.19
54 0.2
55 0.25
56 0.3
57 0.34
58 0.44
59 0.53
60 0.57
61 0.62
62 0.67
63 0.72
64 0.76
65 0.8
66 0.81
67 0.76
68 0.78
69 0.79