Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1J7IUC8

Protein Details
Accession A0A1J7IUC8    Localization Confidence Low Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
152-178GGTKTQKKLGRAERRRRIKEEIQRLAQHydrophilic
NLS Segment(s)
PositionSequence
155-170KTQKKLGRAERRRRIK
Subcellular Location(s) mito 15, extr 5, cyto_nucl 4.5, cyto 3.5, nucl 2.5
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MLLTSSQVSIAASSSVVLVFTSALFLSGYAIQQRTLRDLREAIKPSPRPKPQIFLPDRFRTSTTELADGTVVVVDVDPGRPEAYRPPRRPEREQVVVEVRPTVAGDEAEDVRDAGRDRLDDAVEVLREGRHGGESLPDDGEKERDGLKAEEGGTKTQKKLGRAERRRRIKEEIQRLAQGDKRGVYQPRLW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.07
3 0.06
4 0.06
5 0.05
6 0.05
7 0.05
8 0.06
9 0.05
10 0.06
11 0.06
12 0.06
13 0.07
14 0.08
15 0.09
16 0.12
17 0.13
18 0.14
19 0.16
20 0.18
21 0.22
22 0.24
23 0.24
24 0.24
25 0.27
26 0.29
27 0.35
28 0.38
29 0.35
30 0.42
31 0.47
32 0.49
33 0.56
34 0.59
35 0.58
36 0.57
37 0.59
38 0.57
39 0.61
40 0.61
41 0.59
42 0.61
43 0.6
44 0.6
45 0.56
46 0.51
47 0.43
48 0.42
49 0.39
50 0.33
51 0.27
52 0.25
53 0.24
54 0.22
55 0.18
56 0.14
57 0.08
58 0.06
59 0.04
60 0.03
61 0.03
62 0.03
63 0.04
64 0.04
65 0.05
66 0.05
67 0.05
68 0.06
69 0.15
70 0.26
71 0.35
72 0.39
73 0.47
74 0.56
75 0.63
76 0.68
77 0.67
78 0.64
79 0.62
80 0.59
81 0.54
82 0.49
83 0.43
84 0.37
85 0.29
86 0.21
87 0.13
88 0.13
89 0.09
90 0.05
91 0.05
92 0.05
93 0.06
94 0.06
95 0.07
96 0.07
97 0.06
98 0.06
99 0.07
100 0.08
101 0.07
102 0.08
103 0.08
104 0.09
105 0.11
106 0.11
107 0.1
108 0.1
109 0.11
110 0.1
111 0.1
112 0.09
113 0.07
114 0.08
115 0.08
116 0.07
117 0.06
118 0.07
119 0.07
120 0.1
121 0.12
122 0.13
123 0.14
124 0.13
125 0.13
126 0.14
127 0.15
128 0.12
129 0.12
130 0.12
131 0.12
132 0.15
133 0.15
134 0.15
135 0.17
136 0.17
137 0.21
138 0.21
139 0.24
140 0.28
141 0.31
142 0.31
143 0.34
144 0.37
145 0.36
146 0.44
147 0.51
148 0.55
149 0.63
150 0.73
151 0.77
152 0.85
153 0.89
154 0.85
155 0.83
156 0.82
157 0.82
158 0.82
159 0.8
160 0.75
161 0.71
162 0.67
163 0.64
164 0.58
165 0.52
166 0.45
167 0.37
168 0.35
169 0.38
170 0.41