Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C0NBG2

Protein Details
Accession C0NBG2    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
3-31DGETLQATKRHRNKKDKRRHNVVGDRAAKBasic
NLS Segment(s)
PositionSequence
11-45KRHRNKKDKRRHNVVGDRAAKAGTPGAALKSLERK
Subcellular Location(s) nucl 19.5, cyto_nucl 12.5, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MYDGETLQATKRHRNKKDKRRHNVVGDRAAKAGTPGAALKSLERKNKLKAFDPSLSHGLSIFMCSQMQKVLDPSSFVKSARSERVIGAFQGQQRSSALHIDPENAYARKIVVSI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.7
2 0.78
3 0.84
4 0.91
5 0.92
6 0.93
7 0.93
8 0.91
9 0.91
10 0.89
11 0.86
12 0.85
13 0.77
14 0.68
15 0.58
16 0.49
17 0.38
18 0.29
19 0.22
20 0.12
21 0.09
22 0.08
23 0.09
24 0.1
25 0.1
26 0.11
27 0.19
28 0.24
29 0.29
30 0.34
31 0.37
32 0.43
33 0.48
34 0.5
35 0.47
36 0.47
37 0.47
38 0.46
39 0.45
40 0.41
41 0.38
42 0.35
43 0.29
44 0.23
45 0.18
46 0.13
47 0.12
48 0.09
49 0.07
50 0.07
51 0.07
52 0.07
53 0.08
54 0.09
55 0.08
56 0.1
57 0.12
58 0.11
59 0.14
60 0.15
61 0.18
62 0.18
63 0.18
64 0.19
65 0.2
66 0.25
67 0.28
68 0.29
69 0.27
70 0.27
71 0.31
72 0.29
73 0.26
74 0.24
75 0.22
76 0.22
77 0.27
78 0.26
79 0.23
80 0.22
81 0.23
82 0.22
83 0.22
84 0.2
85 0.19
86 0.2
87 0.22
88 0.22
89 0.23
90 0.27
91 0.24
92 0.24
93 0.19
94 0.19