Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1J7J364

Protein Details
Accession A0A1J7J364    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
34-58AFNLVLKTNKKRRKEKEIKDSPEISHydrophilic
NLS Segment(s)
PositionSequence
43-49KKRRKEK
Subcellular Location(s) nucl 22, cyto_nucl 14, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR001892  Ribosomal_S13  
Gene Ontology GO:0005840  C:ribosome  
GO:0003723  F:RNA binding  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Amino Acid Sequences KAKTLFATLSFENDKAKEILRQNRIDRLTSILKAFNLVLKTNKKRRKEKEIKDSPEISSDRKFDDMLAYMLTN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.21
3 0.21
4 0.23
5 0.28
6 0.37
7 0.41
8 0.48
9 0.49
10 0.55
11 0.56
12 0.51
13 0.43
14 0.39
15 0.35
16 0.3
17 0.28
18 0.22
19 0.2
20 0.19
21 0.18
22 0.15
23 0.13
24 0.13
25 0.17
26 0.24
27 0.32
28 0.41
29 0.49
30 0.55
31 0.65
32 0.72
33 0.78
34 0.81
35 0.83
36 0.84
37 0.87
38 0.85
39 0.82
40 0.76
41 0.66
42 0.62
43 0.53
44 0.46
45 0.4
46 0.35
47 0.31
48 0.3
49 0.29
50 0.23
51 0.25
52 0.23
53 0.19