Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1J7IJP2

Protein Details
Accession A0A1J7IJP2    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
63-91RKTTHRFRCLRQGQKRRERKKDNSLAQSKBasic
NLS Segment(s)
PositionSequence
76-83QKRRERKK
Subcellular Location(s) nucl 10mito 10mito_nucl 10
Family & Domain DBs
Amino Acid Sequences MTADFMSCKLFTSGLHSCQHQVSTTASIPGCPVVYYIFPTIEKIMPIPSSERKMPPCMPERTRKTTHRFRCLRQGQKRRERKKDNSLAQSKTQKPRQQALQNILRVAPFRNKLNCSFLPLFYGITTDMDQGKGELERGSRDAYTWTVVTLRAAVIVRKTPSRRVELLAAEDGGEAVIVAWSIP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.3
3 0.3
4 0.31
5 0.33
6 0.34
7 0.27
8 0.24
9 0.21
10 0.23
11 0.22
12 0.24
13 0.22
14 0.21
15 0.2
16 0.2
17 0.17
18 0.12
19 0.12
20 0.09
21 0.1
22 0.13
23 0.14
24 0.14
25 0.14
26 0.15
27 0.17
28 0.17
29 0.16
30 0.14
31 0.15
32 0.14
33 0.15
34 0.18
35 0.21
36 0.24
37 0.28
38 0.32
39 0.33
40 0.39
41 0.41
42 0.43
43 0.45
44 0.49
45 0.51
46 0.56
47 0.6
48 0.61
49 0.65
50 0.66
51 0.67
52 0.7
53 0.74
54 0.74
55 0.72
56 0.68
57 0.72
58 0.74
59 0.76
60 0.76
61 0.77
62 0.77
63 0.82
64 0.89
65 0.88
66 0.89
67 0.88
68 0.86
69 0.87
70 0.86
71 0.84
72 0.83
73 0.79
74 0.71
75 0.68
76 0.67
77 0.63
78 0.6
79 0.6
80 0.54
81 0.52
82 0.54
83 0.56
84 0.55
85 0.54
86 0.53
87 0.53
88 0.5
89 0.46
90 0.41
91 0.33
92 0.27
93 0.24
94 0.22
95 0.19
96 0.22
97 0.26
98 0.29
99 0.31
100 0.37
101 0.36
102 0.37
103 0.36
104 0.31
105 0.29
106 0.27
107 0.24
108 0.17
109 0.18
110 0.11
111 0.11
112 0.11
113 0.1
114 0.1
115 0.1
116 0.1
117 0.09
118 0.1
119 0.09
120 0.09
121 0.09
122 0.1
123 0.11
124 0.13
125 0.15
126 0.14
127 0.14
128 0.15
129 0.15
130 0.16
131 0.14
132 0.13
133 0.12
134 0.13
135 0.13
136 0.11
137 0.1
138 0.1
139 0.11
140 0.12
141 0.14
142 0.19
143 0.21
144 0.28
145 0.32
146 0.38
147 0.43
148 0.48
149 0.48
150 0.47
151 0.5
152 0.46
153 0.47
154 0.41
155 0.35
156 0.28
157 0.25
158 0.21
159 0.15
160 0.11
161 0.06
162 0.04
163 0.04