Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C0NWU9

Protein Details
Accession C0NWU9    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
13-32SIPASTSKAKPKPERLPITVHydrophilic
200-229RGEGRRERVERIKRNERRMRANERRAGRAKBasic
NLS Segment(s)
PositionSequence
121-149ELFARKKGIGKYNKKLGSGGGSAEAERRK
187-230KKEEGLRREGKGIRGEGRRERVERIKRNERRMRANERRAGRAKE
Subcellular Location(s) mito 20.5, cyto_mito 12.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007023  Ribosom_reg  
Gene Ontology GO:0005634  C:nucleus  
GO:0042254  P:ribosome biogenesis  
Pfam View protein in Pfam  
PF04939  RRS1  
Amino Acid Sequences MAIADMVGSTSTSIPASTSKAKPKPERLPITVEKPTPYTFDLGHLLALDPNPLILSNDTSLNAALTATARDGAQSLLNQLLTTCTITSTTRDGILLSLPPRTTLLPRFKPLPAPKQPTKWELFARKKGIGKYNKKLGSGGGSAEAERRKKLVYDEASGEWVPRWGYKGKNKGGENDWLVEVDEKVWKKEEGLRREGKGIRGEGRRERVERIKRNERRMRANERRAGRAKE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.1
3 0.15
4 0.22
5 0.28
6 0.37
7 0.44
8 0.54
9 0.62
10 0.7
11 0.75
12 0.78
13 0.8
14 0.74
15 0.76
16 0.73
17 0.71
18 0.67
19 0.59
20 0.51
21 0.46
22 0.44
23 0.38
24 0.33
25 0.27
26 0.21
27 0.22
28 0.23
29 0.2
30 0.19
31 0.16
32 0.15
33 0.14
34 0.13
35 0.1
36 0.07
37 0.07
38 0.07
39 0.07
40 0.07
41 0.07
42 0.09
43 0.1
44 0.11
45 0.12
46 0.12
47 0.12
48 0.1
49 0.09
50 0.07
51 0.06
52 0.05
53 0.05
54 0.05
55 0.06
56 0.06
57 0.06
58 0.06
59 0.07
60 0.08
61 0.07
62 0.08
63 0.09
64 0.09
65 0.09
66 0.08
67 0.08
68 0.08
69 0.08
70 0.07
71 0.06
72 0.08
73 0.09
74 0.1
75 0.12
76 0.12
77 0.12
78 0.12
79 0.11
80 0.1
81 0.1
82 0.11
83 0.09
84 0.11
85 0.1
86 0.1
87 0.11
88 0.12
89 0.14
90 0.19
91 0.27
92 0.29
93 0.31
94 0.34
95 0.34
96 0.41
97 0.44
98 0.46
99 0.46
100 0.49
101 0.51
102 0.55
103 0.58
104 0.55
105 0.52
106 0.46
107 0.44
108 0.46
109 0.5
110 0.5
111 0.51
112 0.5
113 0.51
114 0.51
115 0.54
116 0.54
117 0.55
118 0.55
119 0.6
120 0.59
121 0.56
122 0.52
123 0.45
124 0.39
125 0.31
126 0.24
127 0.17
128 0.14
129 0.13
130 0.16
131 0.19
132 0.17
133 0.17
134 0.17
135 0.16
136 0.17
137 0.2
138 0.25
139 0.25
140 0.27
141 0.3
142 0.29
143 0.31
144 0.3
145 0.27
146 0.18
147 0.16
148 0.13
149 0.11
150 0.13
151 0.14
152 0.22
153 0.3
154 0.4
155 0.45
156 0.53
157 0.54
158 0.57
159 0.56
160 0.56
161 0.49
162 0.42
163 0.36
164 0.28
165 0.27
166 0.22
167 0.18
168 0.12
169 0.16
170 0.15
171 0.16
172 0.18
173 0.18
174 0.19
175 0.28
176 0.36
177 0.37
178 0.45
179 0.5
180 0.49
181 0.57
182 0.58
183 0.55
184 0.52
185 0.49
186 0.48
187 0.48
188 0.53
189 0.55
190 0.59
191 0.61
192 0.57
193 0.6
194 0.63
195 0.67
196 0.7
197 0.71
198 0.75
199 0.77
200 0.85
201 0.88
202 0.86
203 0.86
204 0.86
205 0.87
206 0.87
207 0.88
208 0.85
209 0.81
210 0.83