Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1J7JPU2

Protein Details
Accession A0A1J7JPU2    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
45-68DGEMPEGKRRRRRKPEITETPEGNBasic
NLS Segment(s)
PositionSequence
51-59GKRRRRRKP
Subcellular Location(s) mito 9, plas 7, E.R. 3, golg 3, extr 2, vacu 2
Family & Domain DBs
Amino Acid Sequences MPPPHLHPRSRMTSSLFATTVFASFFVVALPHILPCPAPRVKYADGEMPEGKRRRRRKPEITETPEGNIVDFGSSIEDEGPQISKTKRECPVPKPGGAVGELLGFKKTTESNTRQGQDQASR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.48
3 0.41
4 0.33
5 0.3
6 0.27
7 0.21
8 0.14
9 0.12
10 0.09
11 0.08
12 0.08
13 0.06
14 0.06
15 0.05
16 0.07
17 0.07
18 0.06
19 0.06
20 0.07
21 0.07
22 0.08
23 0.14
24 0.15
25 0.16
26 0.18
27 0.24
28 0.26
29 0.29
30 0.3
31 0.29
32 0.27
33 0.3
34 0.3
35 0.26
36 0.31
37 0.33
38 0.37
39 0.41
40 0.49
41 0.56
42 0.65
43 0.73
44 0.76
45 0.82
46 0.87
47 0.89
48 0.87
49 0.8
50 0.7
51 0.61
52 0.52
53 0.41
54 0.31
55 0.2
56 0.12
57 0.08
58 0.07
59 0.06
60 0.05
61 0.05
62 0.05
63 0.05
64 0.05
65 0.05
66 0.05
67 0.06
68 0.06
69 0.1
70 0.1
71 0.16
72 0.19
73 0.27
74 0.32
75 0.41
76 0.47
77 0.49
78 0.6
79 0.59
80 0.57
81 0.53
82 0.49
83 0.41
84 0.35
85 0.3
86 0.19
87 0.17
88 0.16
89 0.13
90 0.13
91 0.11
92 0.1
93 0.13
94 0.14
95 0.17
96 0.26
97 0.31
98 0.38
99 0.47
100 0.49
101 0.5
102 0.52