Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1J7JLJ2

Protein Details
Accession A0A1J7JLJ2   
Localization Confidence Medium
Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
223-250NGKAEAKKPGRPAKKDKKPIEKAKEVVGBasic
NLS Segment(s)
PositionSequence
213-216KKAK
221-255GTNGKAEAKKPGRPAKKDKKPIEKAKEVVGRTLRK
Subcellular Location(s) nucl 14, cyto_nucl 11.833, cyto 7.5, cyto_pero 6.166, pero 3.5
Family & Domain DBs
Amino Acid Sequences MAAEVDQATAQEQITPAQETSNAPEPPKVPEEAQGVKPTEDKAPEDKPPIDTEPAKVDDPVTSTLPVGAAAAGDKQEAIAPMEPQAAPTEPAKAEDPVAETAPVGTTAGGEKQEDIAPKEDPPAMSGALGDAPVPSDLAAAPADEAVKESAAEEKPAEEKPAEEKIAPQTNGAEKEDVEMAQPPAPEEAANAPVPTGEKRKAEEPAPTNGEAKKAKTDTNGTNGKAEAKKPGRPAKKDKKPIEKAKEVVGRTLRKTRSQGPIDQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.16
3 0.15
4 0.14
5 0.17
6 0.17
7 0.22
8 0.28
9 0.28
10 0.27
11 0.31
12 0.31
13 0.34
14 0.36
15 0.33
16 0.25
17 0.29
18 0.35
19 0.36
20 0.39
21 0.39
22 0.38
23 0.37
24 0.37
25 0.33
26 0.31
27 0.29
28 0.29
29 0.28
30 0.31
31 0.35
32 0.4
33 0.4
34 0.37
35 0.39
36 0.39
37 0.39
38 0.35
39 0.32
40 0.32
41 0.33
42 0.32
43 0.27
44 0.25
45 0.2
46 0.21
47 0.22
48 0.17
49 0.15
50 0.14
51 0.14
52 0.13
53 0.12
54 0.09
55 0.06
56 0.05
57 0.05
58 0.05
59 0.05
60 0.05
61 0.05
62 0.05
63 0.06
64 0.06
65 0.08
66 0.09
67 0.09
68 0.1
69 0.12
70 0.12
71 0.12
72 0.13
73 0.11
74 0.12
75 0.12
76 0.14
77 0.12
78 0.14
79 0.15
80 0.14
81 0.14
82 0.13
83 0.15
84 0.13
85 0.13
86 0.11
87 0.1
88 0.09
89 0.09
90 0.08
91 0.06
92 0.04
93 0.04
94 0.04
95 0.06
96 0.06
97 0.06
98 0.06
99 0.08
100 0.1
101 0.11
102 0.12
103 0.13
104 0.13
105 0.13
106 0.15
107 0.14
108 0.13
109 0.12
110 0.12
111 0.1
112 0.09
113 0.08
114 0.07
115 0.06
116 0.06
117 0.05
118 0.03
119 0.04
120 0.04
121 0.04
122 0.03
123 0.03
124 0.03
125 0.04
126 0.05
127 0.04
128 0.04
129 0.05
130 0.05
131 0.04
132 0.05
133 0.04
134 0.04
135 0.04
136 0.05
137 0.09
138 0.09
139 0.1
140 0.09
141 0.1
142 0.12
143 0.13
144 0.14
145 0.1
146 0.11
147 0.14
148 0.19
149 0.19
150 0.17
151 0.18
152 0.24
153 0.3
154 0.3
155 0.26
156 0.24
157 0.27
158 0.3
159 0.29
160 0.23
161 0.16
162 0.17
163 0.17
164 0.15
165 0.12
166 0.11
167 0.11
168 0.12
169 0.12
170 0.11
171 0.11
172 0.11
173 0.1
174 0.09
175 0.1
176 0.12
177 0.12
178 0.11
179 0.11
180 0.11
181 0.13
182 0.15
183 0.18
184 0.2
185 0.22
186 0.25
187 0.29
188 0.32
189 0.33
190 0.39
191 0.37
192 0.4
193 0.42
194 0.41
195 0.4
196 0.36
197 0.41
198 0.35
199 0.34
200 0.34
201 0.32
202 0.33
203 0.36
204 0.42
205 0.39
206 0.45
207 0.49
208 0.43
209 0.43
210 0.41
211 0.43
212 0.4
213 0.37
214 0.39
215 0.38
216 0.42
217 0.49
218 0.59
219 0.62
220 0.67
221 0.77
222 0.78
223 0.83
224 0.88
225 0.89
226 0.9
227 0.91
228 0.93
229 0.91
230 0.89
231 0.81
232 0.79
233 0.77
234 0.67
235 0.64
236 0.62
237 0.59
238 0.56
239 0.63
240 0.58
241 0.58
242 0.63
243 0.64
244 0.66