Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1J7J9L2

Protein Details
Accession A0A1J7J9L2    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MAPARQLWRRKRKIRSLVALCIEHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 22, cyto 5
Family & Domain DBs
Amino Acid Sequences MAPARQLWRRKRKIRSLVALCIETLAKNIEEASVEALEHLPVAILWRVYRYYVAEWSV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.89
2 0.89
3 0.84
4 0.8
5 0.74
6 0.64
7 0.53
8 0.43
9 0.34
10 0.23
11 0.17
12 0.11
13 0.07
14 0.07
15 0.07
16 0.06
17 0.06
18 0.06
19 0.07
20 0.06
21 0.06
22 0.06
23 0.06
24 0.06
25 0.06
26 0.05
27 0.03
28 0.03
29 0.05
30 0.06
31 0.07
32 0.08
33 0.1
34 0.11
35 0.12
36 0.15
37 0.16
38 0.18