Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1J7J3B1

Protein Details
Accession A0A1J7J3B1    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
73-96QERKSSGKKSHYKKVVARRRWQQGHydrophilic
NLS Segment(s)
PositionSequence
76-92KSSGKKSHYKKVVARRR
Subcellular Location(s) nucl 14, mito_nucl 12.333, mito 9.5, cyto_nucl 9.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR039883  Fcf2/DNTTIP2  
IPR014810  Fcf2_C  
Gene Ontology GO:0005634  C:nucleus  
Pfam View protein in Pfam  
PF08698  Fcf2  
Amino Acid Sequences MRDVLAMGKQHFKKDTRKDPFPEFSQVGTLVEGPTEFYSARLTKKERKRTLVEEVLSSGQALSKFKSKYSEIQERKSSGKKSHYKKVVARRRWQQG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.65
3 0.65
4 0.71
5 0.72
6 0.74
7 0.75
8 0.69
9 0.65
10 0.55
11 0.46
12 0.4
13 0.34
14 0.27
15 0.21
16 0.17
17 0.1
18 0.09
19 0.08
20 0.07
21 0.07
22 0.07
23 0.07
24 0.07
25 0.1
26 0.12
27 0.15
28 0.18
29 0.23
30 0.31
31 0.4
32 0.51
33 0.53
34 0.58
35 0.61
36 0.61
37 0.64
38 0.61
39 0.53
40 0.43
41 0.38
42 0.32
43 0.27
44 0.22
45 0.14
46 0.09
47 0.09
48 0.1
49 0.09
50 0.15
51 0.16
52 0.17
53 0.22
54 0.23
55 0.3
56 0.37
57 0.47
58 0.47
59 0.54
60 0.59
61 0.57
62 0.61
63 0.6
64 0.58
65 0.55
66 0.59
67 0.61
68 0.63
69 0.7
70 0.73
71 0.75
72 0.77
73 0.81
74 0.81
75 0.82
76 0.84