Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1J7IGN9

Protein Details
Accession A0A1J7IGN9    Localization Confidence Medium Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
45-72NPQPDTQHRRRSRLRLRRHPRRDGPLLPBasic
NLS Segment(s)
PositionSequence
53-77RRRSRLRLRRHPRRDGPLLPGARPS
Subcellular Location(s) nucl 15, mito 9, cyto_nucl 9
Family & Domain DBs
Amino Acid Sequences MATRHSTEYHVRSRWATSDCARTGRRAARPAAGVPQTPYRSEKYNPQPDTQHRRRSRLRLRRHPRRDGPLLPGARPSPRWPGDTPLHRLLRARVMTRLLRMRDMLCILPGHFGERLTAPISVSKYTGMTTAVAAQFTSHHSDGLQCRGYSRRGCQLQQMP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.41
3 0.39
4 0.36
5 0.41
6 0.41
7 0.46
8 0.44
9 0.42
10 0.47
11 0.49
12 0.52
13 0.49
14 0.49
15 0.46
16 0.48
17 0.46
18 0.45
19 0.4
20 0.34
21 0.31
22 0.36
23 0.33
24 0.33
25 0.34
26 0.29
27 0.31
28 0.32
29 0.39
30 0.42
31 0.5
32 0.51
33 0.52
34 0.56
35 0.61
36 0.7
37 0.69
38 0.69
39 0.65
40 0.7
41 0.74
42 0.77
43 0.79
44 0.78
45 0.8
46 0.81
47 0.86
48 0.89
49 0.91
50 0.9
51 0.86
52 0.84
53 0.8
54 0.72
55 0.66
56 0.63
57 0.55
58 0.45
59 0.4
60 0.33
61 0.27
62 0.26
63 0.23
64 0.23
65 0.24
66 0.27
67 0.26
68 0.3
69 0.35
70 0.39
71 0.42
72 0.41
73 0.4
74 0.37
75 0.38
76 0.33
77 0.34
78 0.32
79 0.28
80 0.23
81 0.26
82 0.27
83 0.31
84 0.35
85 0.29
86 0.27
87 0.28
88 0.26
89 0.23
90 0.24
91 0.19
92 0.15
93 0.14
94 0.13
95 0.13
96 0.13
97 0.13
98 0.11
99 0.11
100 0.11
101 0.11
102 0.12
103 0.12
104 0.12
105 0.11
106 0.14
107 0.16
108 0.15
109 0.15
110 0.14
111 0.14
112 0.14
113 0.14
114 0.12
115 0.1
116 0.1
117 0.14
118 0.14
119 0.13
120 0.13
121 0.12
122 0.12
123 0.14
124 0.2
125 0.16
126 0.15
127 0.15
128 0.21
129 0.24
130 0.31
131 0.33
132 0.26
133 0.29
134 0.33
135 0.4
136 0.4
137 0.43
138 0.46
139 0.48
140 0.5